BLASTX nr result
ID: Achyranthes23_contig00017192
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00017192 (649 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_004300276.1| putative inclusion body protein [Sweet potat... 59 9e-07 >ref|YP_004300276.1| putative inclusion body protein [Sweet potato vein clearing virus] gi|325698383|gb|ADZ45066.1| putative inclusion body protein [Sweet potato vein clearing virus] Length = 273 Score = 59.3 bits (142), Expect = 9e-07 Identities = 29/101 (28%), Positives = 54/101 (53%), Gaps = 3/101 (2%) Frame = +3 Query: 3 DILDTKRIYNIRSIHEALCTSL--KRPVWVYYSRNNLLVYALSQLDKPGSRDILRQWQET 176 D KR+ ++++ + L + P+W+Y++R N L+Y+L++ KP + +R W T Sbjct: 133 DFFANKRVIQLKNVVDELANNYTSNNPIWIYHNRENTLIYSLAKEVKPKDMEDIRLWIMT 192 Query: 177 IEKPDDIQKTPAIQQLCLTSSKKA-LCKLFSTATHHQCSRC 296 + P+ T AI++ ++ K CK+ S H C+RC Sbjct: 193 LINPEKNPLTRAIKKEFISDKIKGHYCKIISEYPDHLCTRC 233