BLASTX nr result
ID: Achyranthes23_contig00016980
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00016980 (189 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004155502.1| PREDICTED: calmodulin-binding transcription ... 55 1e-05 ref|XP_004137052.1| PREDICTED: calmodulin-binding transcription ... 55 1e-05 >ref|XP_004155502.1| PREDICTED: calmodulin-binding transcription activator 2-like [Cucumis sativus] Length = 247 Score = 55.1 bits (131), Expect = 1e-05 Identities = 29/64 (45%), Positives = 36/64 (56%), Gaps = 1/64 (1%) Frame = +1 Query: 1 RSYWLLEEEFMHIVFVHYLEVKGNRSSI-REAEPXXXXXXXXXXXXXXXXXXYNEAFTGN 177 RSYW+LEE MHIVFVHYLEVKGNR+++ E +N+A + N Sbjct: 115 RSYWMLEEHLMHIVFVHYLEVKGNRTNVGAVVETDEVSTSSQKSRSSSYSSSHNQAASEN 174 Query: 178 AGSP 189 A SP Sbjct: 175 ADSP 178 >ref|XP_004137052.1| PREDICTED: calmodulin-binding transcription activator 2-like [Cucumis sativus] Length = 1067 Score = 55.1 bits (131), Expect = 1e-05 Identities = 29/64 (45%), Positives = 36/64 (56%), Gaps = 1/64 (1%) Frame = +1 Query: 1 RSYWLLEEEFMHIVFVHYLEVKGNRSSI-REAEPXXXXXXXXXXXXXXXXXXYNEAFTGN 177 RSYW+LEE MHIVFVHYLEVKGNR+++ E +N+A + N Sbjct: 111 RSYWMLEEHLMHIVFVHYLEVKGNRTNVGAVVETDEVSTSSQKSRSSSYSSSHNQAASEN 170 Query: 178 AGSP 189 A SP Sbjct: 171 ADSP 174