BLASTX nr result
ID: Achyranthes23_contig00016408
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00016408 (587 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC23156.1| hypothetical protein L484_018287 [Morus notabilis] 56 8e-06 ref|XP_002280993.1| PREDICTED: uncharacterized protein LOC100256... 56 8e-06 >gb|EXC23156.1| hypothetical protein L484_018287 [Morus notabilis] Length = 149 Score = 55.8 bits (133), Expect = 8e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +1 Query: 22 MCYVGKATKIFIFIVIALAITGLILGFSLLKNGL 123 MCYVGKATKIFIFIV L + GL+LGF LL++GL Sbjct: 1 MCYVGKATKIFIFIVTVLVVLGLVLGFGLLRHGL 34 >ref|XP_002280993.1| PREDICTED: uncharacterized protein LOC100256871 [Vitis vinifera] Length = 137 Score = 55.8 bits (133), Expect = 8e-06 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = +1 Query: 22 MCYVGKATKIFIFIVIALAITGLILGFSLLKNGL 123 MCYVGKATKIFIFIV LA+TGL++GF LL++ + Sbjct: 1 MCYVGKATKIFIFIVTVLAVTGLVIGFGLLRHSI 34