BLASTX nr result
ID: Achyranthes23_contig00016394
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00016394 (431 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN70398.1| hypothetical protein VITISV_039104 [Vitis vinifera] 43 5e-06 >emb|CAN70398.1| hypothetical protein VITISV_039104 [Vitis vinifera] Length = 796 Score = 43.1 bits (100), Expect(2) = 5e-06 Identities = 17/37 (45%), Positives = 25/37 (67%) Frame = +1 Query: 307 SVVGHKYVLVAFDYLTKWIEEVYSRKVISRNIAKFLE 417 S GH+Y+LVA DY TKW+E K+ + +AKF++ Sbjct: 598 SFSGHEYILVAIDYFTKWVEAASYAKLTAAKVAKFIK 634 Score = 32.7 bits (73), Expect(2) = 5e-06 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = +2 Query: 236 IYSYTSRWPFSTWEIDTIRKIVP 304 +++ TS WPFS W ID I KI P Sbjct: 574 LHALTSPWPFSVWGIDIIGKISP 596