BLASTX nr result
ID: Achyranthes23_contig00016197
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00016197 (495 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006409812.1| hypothetical protein EUTSA_v10017487mg [Eutr... 90 3e-16 gb|AEX07592.1| cdk-subunit 1, partial [Brassica juncea] 90 3e-16 gb|EXC24899.1| Cyclin-dependent kinases regulatory subunit 2 [Mo... 88 1e-15 ref|XP_006348021.1| PREDICTED: cyclin-dependent kinases regulato... 88 1e-15 ref|XP_006384972.1| hypothetical protein POPTR_0004s22710g, part... 88 1e-15 ref|XP_004985721.1| PREDICTED: cyclin-dependent kinases regulato... 88 1e-15 gb|EOY33668.1| Cyclin-dependent kinases regulatory subunit 1 [Th... 88 1e-15 ref|XP_004506113.1| PREDICTED: cyclin-dependent kinases regulato... 88 1e-15 ref|XP_006295329.1| hypothetical protein CARUB_v10024417mg [Caps... 88 1e-15 ref|XP_004294559.1| PREDICTED: cyclin-dependent kinases regulato... 88 1e-15 gb|EMJ08726.1| hypothetical protein PRUPE_ppa014100mg [Prunus pe... 88 1e-15 ref|XP_004250987.1| PREDICTED: cyclin-dependent kinases regulato... 88 1e-15 ref|XP_004171476.1| PREDICTED: cyclin-dependent kinases regulato... 88 1e-15 ref|XP_002331485.1| regulatory subunit of cyclin-dependent kinas... 88 1e-15 gb|AFK45733.1| unknown [Lotus japonicus] 88 1e-15 ref|XP_003606312.1| Cyclin-dependent kinases regulatory subunit ... 88 1e-15 gb|AEI55454.1| cyclin-dependent kinase subunit 1 [Malus domestic... 88 1e-15 ref|XP_002879125.1| cdk-subunit 1 [Arabidopsis lyrata subsp. lyr... 88 1e-15 ref|XP_002523737.1| Cyclin-dependent kinases regulatory subunit,... 88 1e-15 gb|ABE01245.1| cyclin-dependent kinases regulatory subunit [Came... 88 1e-15 >ref|XP_006409812.1| hypothetical protein EUTSA_v10017487mg [Eutrema salsugineum] gi|557110981|gb|ESQ51265.1| hypothetical protein EUTSA_v10017487mg [Eutrema salsugineum] Length = 87 Score = 90.1 bits (222), Expect = 3e-16 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = +3 Query: 3 NRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRTLNH 125 NRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRTLN+ Sbjct: 33 NRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRTLNY 73 >gb|AEX07592.1| cdk-subunit 1, partial [Brassica juncea] Length = 76 Score = 90.1 bits (222), Expect = 3e-16 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = +3 Query: 3 NRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRTLNH 125 NRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRTLN+ Sbjct: 21 NRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRTLNY 61 >gb|EXC24899.1| Cyclin-dependent kinases regulatory subunit 2 [Morus notabilis] Length = 82 Score = 87.8 bits (216), Expect = 1e-15 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = +3 Query: 3 NRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRTLNH 125 NRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRR LN+ Sbjct: 33 NRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 73 >ref|XP_006348021.1| PREDICTED: cyclin-dependent kinases regulatory subunit 1-like [Solanum tuberosum] Length = 88 Score = 87.8 bits (216), Expect = 1e-15 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = +3 Query: 3 NRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRTLNH 125 NRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRR LN+ Sbjct: 33 NRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 73 >ref|XP_006384972.1| hypothetical protein POPTR_0004s22710g, partial [Populus trichocarpa] gi|550341740|gb|ERP62769.1| hypothetical protein POPTR_0004s22710g, partial [Populus trichocarpa] Length = 129 Score = 87.8 bits (216), Expect = 1e-15 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = +3 Query: 3 NRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRTLNH 125 NRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRR LN+ Sbjct: 79 NRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 119 >ref|XP_004985721.1| PREDICTED: cyclin-dependent kinases regulatory subunit 1-like [Setaria italica] Length = 90 Score = 87.8 bits (216), Expect = 1e-15 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = +3 Query: 3 NRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRTLNH 125 NRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRR LN+ Sbjct: 33 NRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 73 >gb|EOY33668.1| Cyclin-dependent kinases regulatory subunit 1 [Theobroma cacao] Length = 88 Score = 87.8 bits (216), Expect = 1e-15 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = +3 Query: 3 NRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRTLNH 125 NRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRR LN+ Sbjct: 33 NRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 73 >ref|XP_004506113.1| PREDICTED: cyclin-dependent kinases regulatory subunit 1-like [Cicer arietinum] Length = 88 Score = 87.8 bits (216), Expect = 1e-15 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = +3 Query: 3 NRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRTLNH 125 NRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRR LN+ Sbjct: 33 NRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 73 >ref|XP_006295329.1| hypothetical protein CARUB_v10024417mg [Capsella rubella] gi|482564037|gb|EOA28227.1| hypothetical protein CARUB_v10024417mg [Capsella rubella] Length = 87 Score = 87.8 bits (216), Expect = 1e-15 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = +3 Query: 3 NRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRTLNH 125 NRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRR LN+ Sbjct: 33 NRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 73 >ref|XP_004294559.1| PREDICTED: cyclin-dependent kinases regulatory subunit 1-like [Fragaria vesca subsp. vesca] Length = 85 Score = 87.8 bits (216), Expect = 1e-15 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = +3 Query: 3 NRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRTLNH 125 NRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRR LN+ Sbjct: 33 NRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 73 >gb|EMJ08726.1| hypothetical protein PRUPE_ppa014100mg [Prunus persica] Length = 87 Score = 87.8 bits (216), Expect = 1e-15 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = +3 Query: 3 NRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRTLNH 125 NRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRR LN+ Sbjct: 33 NRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 73 >ref|XP_004250987.1| PREDICTED: cyclin-dependent kinases regulatory subunit 2-like [Solanum lycopersicum] gi|565364675|ref|XP_006349044.1| PREDICTED: cyclin-dependent kinases regulatory subunit 1-like [Solanum tuberosum] Length = 88 Score = 87.8 bits (216), Expect = 1e-15 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = +3 Query: 3 NRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRTLNH 125 NRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRR LN+ Sbjct: 33 NRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 73 >ref|XP_004171476.1| PREDICTED: cyclin-dependent kinases regulatory subunit 2-like [Cucumis sativus] Length = 88 Score = 87.8 bits (216), Expect = 1e-15 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = +3 Query: 3 NRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRTLNH 125 NRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRR LN+ Sbjct: 33 NRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 73 >ref|XP_002331485.1| regulatory subunit of cyclin-dependent kinase [Populus trichocarpa] gi|27435806|gb|AAO13226.1|AF149014_1 CKS1 protein [Populus tremula x Populus tremuloides] gi|118488360|gb|ABK95998.1| unknown [Populus trichocarpa] gi|118489795|gb|ABK96697.1| unknown [Populus trichocarpa x Populus deltoides] Length = 83 Score = 87.8 bits (216), Expect = 1e-15 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = +3 Query: 3 NRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRTLNH 125 NRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRR LN+ Sbjct: 33 NRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 73 >gb|AFK45733.1| unknown [Lotus japonicus] Length = 88 Score = 87.8 bits (216), Expect = 1e-15 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = +3 Query: 3 NRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRTLNH 125 NRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRR LN+ Sbjct: 33 NRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 73 >ref|XP_003606312.1| Cyclin-dependent kinases regulatory subunit [Medicago truncatula] gi|355507367|gb|AES88509.1| Cyclin-dependent kinases regulatory subunit [Medicago truncatula] gi|388496380|gb|AFK36256.1| unknown [Medicago truncatula] Length = 88 Score = 87.8 bits (216), Expect = 1e-15 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = +3 Query: 3 NRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRTLNH 125 NRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRR LN+ Sbjct: 33 NRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 73 >gb|AEI55454.1| cyclin-dependent kinase subunit 1 [Malus domestica] gi|336442563|gb|AEI55455.1| cyclin-dependent kinase subunit 1 [Malus domestica] Length = 88 Score = 87.8 bits (216), Expect = 1e-15 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = +3 Query: 3 NRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRTLNH 125 NRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRR LN+ Sbjct: 33 NRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 73 >ref|XP_002879125.1| cdk-subunit 1 [Arabidopsis lyrata subsp. lyrata] gi|297324964|gb|EFH55384.1| cdk-subunit 1 [Arabidopsis lyrata subsp. lyrata] Length = 87 Score = 87.8 bits (216), Expect = 1e-15 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = +3 Query: 3 NRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRTLNH 125 NRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRR LN+ Sbjct: 33 NRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 73 >ref|XP_002523737.1| Cyclin-dependent kinases regulatory subunit, putative [Ricinus communis] gi|223537041|gb|EEF38677.1| Cyclin-dependent kinases regulatory subunit, putative [Ricinus communis] Length = 88 Score = 87.8 bits (216), Expect = 1e-15 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = +3 Query: 3 NRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRTLNH 125 NRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRR LN+ Sbjct: 33 NRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 73 >gb|ABE01245.1| cyclin-dependent kinases regulatory subunit [Camellia sinensis] Length = 88 Score = 87.8 bits (216), Expect = 1e-15 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = +3 Query: 3 NRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRTLNH 125 NRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRR LN+ Sbjct: 33 NRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 73