BLASTX nr result
ID: Achyranthes23_contig00016085
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00016085 (524 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY00442.1| Splicing factor PWI domain-containing protein / R... 56 6e-06 >gb|EOY00442.1| Splicing factor PWI domain-containing protein / RNA recognition motif-containing protein isoform 1 [Theobroma cacao] Length = 942 Score = 55.8 bits (133), Expect = 6e-06 Identities = 33/74 (44%), Positives = 43/74 (58%), Gaps = 12/74 (16%) Frame = -1 Query: 197 FTPIPQNPNMPGFPT---QPPGVTSAP-----PQQQPMLP-GQVGQPPLRSPYMPMPNGY 45 F P+PQ +P F QPPGV+S P P Q +P GQV P +R P+ P+PNGY Sbjct: 91 FRPVPQFSPLPNFQAPGVQPPGVSSVPGSVPPPLMQYQVPSGQVPNPAIR-PFAPIPNGY 149 Query: 44 M---GTLPQGSLPP 12 G +PQG++PP Sbjct: 150 AAVPGAVPQGTMPP 163