BLASTX nr result
ID: Achyranthes23_contig00015916
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00015916 (408 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002315228.2| hypothetical protein POPTR_0010s21390g [Popu... 58 2e-06 >ref|XP_002315228.2| hypothetical protein POPTR_0010s21390g [Populus trichocarpa] gi|550330301|gb|EEF01399.2| hypothetical protein POPTR_0010s21390g [Populus trichocarpa] Length = 347 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/45 (60%), Positives = 32/45 (71%) Frame = -1 Query: 408 DLNEQFQRALRVVTRPLTWSEFMLSRQGLLSAFACIVLGVFMASN 274 DL EQFQ+ L VT PLTW+EF LSRQG SA A I++GV + N Sbjct: 298 DLEEQFQKVLVQVTEPLTWTEFWLSRQGAFSALASIIIGVVVGKN 342