BLASTX nr result
ID: Achyranthes23_contig00015847
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00015847 (578 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004230318.1| PREDICTED: transcription factor bHLH149-like... 60 4e-07 ref|XP_006344778.1| PREDICTED: transcription factor bHLH149-like... 57 3e-06 >ref|XP_004230318.1| PREDICTED: transcription factor bHLH149-like [Solanum lycopersicum] Length = 206 Score = 60.1 bits (144), Expect = 4e-07 Identities = 27/40 (67%), Positives = 33/40 (82%) Frame = -2 Query: 121 RWKSQAEQQIYSSKLLEALRYVRRRNPTPAPVSGSRAVRE 2 RW++ EQQIYSSKLL+ALR+VRR N P+PV+ RAVRE Sbjct: 44 RWRTDTEQQIYSSKLLQALRHVRRSNDNPSPVNAGRAVRE 83 >ref|XP_006344778.1| PREDICTED: transcription factor bHLH149-like [Solanum tuberosum] Length = 206 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = -2 Query: 121 RWKSQAEQQIYSSKLLEALRYVRRRNPTPAPVSGSRAVRE 2 RW++ EQQIYSSKLL+ALR+VRR N +PV+ RAVRE Sbjct: 44 RWRTDTEQQIYSSKLLQALRHVRRSNDNQSPVNAGRAVRE 83