BLASTX nr result
ID: Achyranthes23_contig00015338
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00015338 (309 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB37441.1| Pre-rRNA-processing protein esf2 [Morus notabilis] 57 3e-06 ref|XP_006470204.1| PREDICTED: pre-rRNA-processing protein esf2-... 57 3e-06 ref|XP_006446656.1| hypothetical protein CICLE_v10015979mg [Citr... 57 3e-06 ref|XP_006446653.1| hypothetical protein CICLE_v10017686mg, part... 55 7e-06 gb|EMJ17074.1| hypothetical protein PRUPE_ppa010533mg [Prunus pe... 55 1e-05 >gb|EXB37441.1| Pre-rRNA-processing protein esf2 [Morus notabilis] Length = 483 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +2 Query: 203 ADKKGVCYLSRIPPKMDPRIVRQLLSSYSEIQRLY 307 A+K+G+CYLSR+PP MDP +RQLLS Y EIQR+Y Sbjct: 126 ANKRGICYLSRVPPHMDPFKLRQLLSQYGEIQRIY 160 >ref|XP_006470204.1| PREDICTED: pre-rRNA-processing protein esf2-like [Citrus sinensis] Length = 315 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +2 Query: 203 ADKKGVCYLSRIPPKMDPRIVRQLLSSYSEIQRLY 307 AD++G+CYLSRIPP MDP +RQ+LS Y EIQR+Y Sbjct: 98 ADQRGICYLSRIPPHMDPVKLRQILSQYGEIQRIY 132 >ref|XP_006446656.1| hypothetical protein CICLE_v10015979mg [Citrus clementina] gi|567908687|ref|XP_006446657.1| hypothetical protein CICLE_v10015979mg [Citrus clementina] gi|567908689|ref|XP_006446658.1| hypothetical protein CICLE_v10015979mg [Citrus clementina] gi|557549267|gb|ESR59896.1| hypothetical protein CICLE_v10015979mg [Citrus clementina] gi|557549268|gb|ESR59897.1| hypothetical protein CICLE_v10015979mg [Citrus clementina] gi|557549269|gb|ESR59898.1| hypothetical protein CICLE_v10015979mg [Citrus clementina] Length = 317 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +2 Query: 203 ADKKGVCYLSRIPPKMDPRIVRQLLSSYSEIQRLY 307 AD++G+CYLSRIPP MDP +RQ+LS Y EIQR+Y Sbjct: 99 ADQRGICYLSRIPPHMDPVKLRQILSQYGEIQRIY 133 >ref|XP_006446653.1| hypothetical protein CICLE_v10017686mg, partial [Citrus clementina] gi|557549264|gb|ESR59893.1| hypothetical protein CICLE_v10017686mg, partial [Citrus clementina] Length = 221 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = +2 Query: 203 ADKKGVCYLSRIPPKMDPRIVRQLLSSYSEIQRLY 307 AD+ G+CYLSRIPP MDP +RQ+LS Y EIQR+Y Sbjct: 60 ADRCGICYLSRIPPHMDPVKLRQILSQYGEIQRIY 94 >gb|EMJ17074.1| hypothetical protein PRUPE_ppa010533mg [Prunus persica] Length = 246 Score = 55.1 bits (131), Expect = 1e-05 Identities = 22/34 (64%), Positives = 29/34 (85%) Frame = +2 Query: 206 DKKGVCYLSRIPPKMDPRIVRQLLSSYSEIQRLY 307 +K+GVCYL RIPP+MDP +RQ+LS + EIQR+Y Sbjct: 20 EKRGVCYLGRIPPRMDPSTLRQMLSQFGEIQRVY 53