BLASTX nr result
ID: Achyranthes23_contig00015281
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00015281 (587 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002313050.2| cyclase associated protein 1 [Populus tricho... 52 6e-07 >ref|XP_002313050.2| cyclase associated protein 1 [Populus trichocarpa] gi|550331542|gb|EEE87005.2| cyclase associated protein 1 [Populus trichocarpa] Length = 468 Score = 52.4 bits (124), Expect(2) = 6e-07 Identities = 28/53 (52%), Positives = 35/53 (66%) Frame = -3 Query: 408 SLYPLGLIWGTSSNATISAFPKATGPAYPHPPSTSLFSVDSTKPSSLQTKTGL 250 S YPLG +W T+ AT SA KA PA P PP SLFS +S++PSS + K G+ Sbjct: 202 SHYPLGPVWSTTGKATASAPSKA--PAPPPPPPASLFSSESSQPSSSKPKEGM 252 Score = 26.9 bits (58), Expect(2) = 6e-07 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -1 Query: 437 NVEWTKALKDLYI 399 +VEW KALKDLY+ Sbjct: 181 HVEWAKALKDLYL 193