BLASTX nr result
ID: Achyranthes23_contig00015009
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00015009 (260 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABJ99599.1| NBS-LRR type resistance protein [Beta vulgaris] 74 2e-11 >gb|ABJ99599.1| NBS-LRR type resistance protein [Beta vulgaris] Length = 1067 Score = 73.9 bits (180), Expect = 2e-11 Identities = 33/54 (61%), Positives = 40/54 (74%) Frame = +2 Query: 95 LPSLHTLKLKALRKLKNMPKWMPKLTSLRNLHV*ECSKSLERRCQEDPQGEDWP 256 LP+L +L + R L+ MP WMPKLTSL L + CS+SLERRCQ+DP GEDWP Sbjct: 1003 LPALESLIISNCRGLRAMPNWMPKLTSLDQLEIWPCSESLERRCQKDPPGEDWP 1056