BLASTX nr result
ID: Achyranthes23_contig00014664
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00014664 (497 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABJ99600.1| NBS-LRR type resistance protein [Beta vulgaris] 66 6e-09 gb|ABJ99599.1| NBS-LRR type resistance protein [Beta vulgaris] 66 6e-09 >gb|ABJ99600.1| NBS-LRR type resistance protein [Beta vulgaris] Length = 1047 Score = 65.9 bits (159), Expect = 6e-09 Identities = 35/72 (48%), Positives = 49/72 (68%), Gaps = 3/72 (4%) Frame = +3 Query: 291 MPYSSLLPSLCTLQLNVLPQL---PKWINFLPALQTLQIYSCEELKAMPDWMPKLTSLRV 461 MP+ SL SL L+L+ LPQL P W+ FL AL+TL I C+ L+++P+WMPKLT+LR Sbjct: 953 MPWRSLSHSLRRLKLSELPQLVDLPSWMQFLEALETLHIDDCKGLESLPNWMPKLTALRH 1012 Query: 462 LDIKWCSKSLEK 497 L + S L++ Sbjct: 1013 LRLSRSSPRLKE 1024 >gb|ABJ99599.1| NBS-LRR type resistance protein [Beta vulgaris] Length = 1067 Score = 65.9 bits (159), Expect = 6e-09 Identities = 38/82 (46%), Positives = 52/82 (63%), Gaps = 6/82 (7%) Frame = +3 Query: 270 VGIDMNVMPYSSLLPSLCTLQL------NVLPQLPKWINFLPALQTLQIYSCEELKAMPD 431 VGID S + SL L++ L LP+W+ +LPAL++L I +C L+AMP+ Sbjct: 963 VGIDNVAWLDSVSMESLQCLEVLYIKDNGELVDLPEWMQYLPALESLIISNCRGLRAMPN 1022 Query: 432 WMPKLTSLRVLDIKWCSKSLEK 497 WMPKLTSL L+I CS+SLE+ Sbjct: 1023 WMPKLTSLDQLEIWPCSESLER 1044