BLASTX nr result
ID: Achyranthes23_contig00014125
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00014125 (320 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABJ99599.1| NBS-LRR type resistance protein [Beta vulgaris] 44 6e-06 >gb|ABJ99599.1| NBS-LRR type resistance protein [Beta vulgaris] Length = 1067 Score = 43.5 bits (101), Expect(3) = 6e-06 Identities = 19/32 (59%), Positives = 26/32 (81%) Frame = +3 Query: 117 KTKLQQRLVGKKYLLVLDDVWTENYKA*CDCA 212 ++++Q +L GKK+LLVLDDVWTE+Y CD A Sbjct: 264 QSRVQGQLGGKKFLLVLDDVWTESYYQWCDLA 295 Score = 25.8 bits (55), Expect(3) = 6e-06 Identities = 11/36 (30%), Positives = 22/36 (61%) Frame = +2 Query: 17 QQEKQLVAQEIVSKVLSSVINQKHNQNLTLTHKQNK 124 Q +KQL ++I+ K+L+S + +Q T+ Q++ Sbjct: 231 QDQKQLDVKDILVKILASATGKNPDQGSTMDQVQSR 266 Score = 25.0 bits (53), Expect(3) = 6e-06 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = +1 Query: 226 GQRESWVVVTTRS 264 G R SW+VVTTRS Sbjct: 301 GARGSWIVVTTRS 313