BLASTX nr result
ID: Achyranthes23_contig00013905
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00013905 (235 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABJ99599.1| NBS-LRR type resistance protein [Beta vulgaris] 70 2e-10 >gb|ABJ99599.1| NBS-LRR type resistance protein [Beta vulgaris] Length = 1067 Score = 70.5 bits (171), Expect = 2e-10 Identities = 39/68 (57%), Positives = 47/68 (69%), Gaps = 6/68 (8%) Frame = -2 Query: 186 SLRILELL------KLSGLPNWVQYLPALETLIISHISPLLHAMPNWMPKLTSLKNLQFY 25 SL+ LE+L +L LP W+QYLPALE+LIIS+ L AMPNWMPKLTSL L+ + Sbjct: 978 SLQCLEVLYIKDNGELVDLPEWMQYLPALESLIISNCRGL-RAMPNWMPKLTSLDQLEIW 1036 Query: 24 GCSRELER 1 CS LER Sbjct: 1037 PCSESLER 1044