BLASTX nr result
ID: Achyranthes23_contig00013887
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00013887 (260 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABJ99599.1| NBS-LRR type resistance protein [Beta vulgaris] 60 4e-07 gb|ABJ99600.1| NBS-LRR type resistance protein [Beta vulgaris] 59 7e-07 >gb|ABJ99599.1| NBS-LRR type resistance protein [Beta vulgaris] Length = 1067 Score = 59.7 bits (143), Expect = 4e-07 Identities = 31/53 (58%), Positives = 37/53 (69%) Frame = -3 Query: 159 LSELPNWVQYLPALETLTISDISPRLHAMPNWMPKLTSLKNLQFKGYSRELKR 1 L +LP W+QYLPALE+L IS+ L AMPNWMPKLTSL L+ S L+R Sbjct: 993 LVDLPEWMQYLPALESLIISNCRG-LRAMPNWMPKLTSLDQLEIWPCSESLER 1044 >gb|ABJ99600.1| NBS-LRR type resistance protein [Beta vulgaris] Length = 1047 Score = 58.9 bits (141), Expect = 7e-07 Identities = 37/86 (43%), Positives = 53/86 (61%), Gaps = 3/86 (3%) Frame = -3 Query: 252 SLIKEEIEGENAGIMTYPCIFPSLRILTLRWLSEL---PNWVQYLPALETLTISDISPRL 82 +L++E+ E E M + + SLR L L L +L P+W+Q+L ALETL I D L Sbjct: 939 NLLEEKREDEVDVDMPWRSLSHSLRRLKLSELPQLVDLPSWMQFLEALETLHIDDCKG-L 997 Query: 81 HAMPNWMPKLTSLKNLQFKGYSRELK 4 ++PNWMPKLT+L++L+ S LK Sbjct: 998 ESLPNWMPKLTALRHLRLSRSSPRLK 1023