BLASTX nr result
ID: Achyranthes23_contig00013875
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00013875 (220 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006383347.1| hypothetical protein POPTR_0005s147101g, par... 58 1e-06 ref|XP_002301714.1| NBS resistance protein [Populus trichocarpa] 58 1e-06 ref|XP_002301713.1| nbs-lrr resistance protein [Populus trichoca... 58 1e-06 ref|XP_006372537.1| hypothetical protein POPTR_0017s02570g [Popu... 57 2e-06 ref|XP_006388711.1| hypothetical protein POPTR_0115s00270g [Popu... 57 2e-06 ref|XP_006372507.1| hypothetical protein POPTR_0017s02290g [Popu... 57 3e-06 ref|XP_006388567.1| hypothetical protein POPTR_0154s00220g [Popu... 57 3e-06 ref|XP_002335004.1| cc-nbs-lrr resistance protein [Populus trich... 57 3e-06 ref|XP_006372509.1| hypothetical protein POPTR_0017s02310g, part... 56 6e-06 ref|XP_006372496.1| hypothetical protein POPTR_0017s02200g [Popu... 56 6e-06 ref|XP_006388570.1| hypothetical protein POPTR_0154s00250g [Popu... 56 6e-06 ref|XP_006388382.1| hypothetical protein POPTR_0202s002003g, par... 56 6e-06 ref|XP_002302910.1| cc-nbs-lrr resistance protein [Populus trich... 56 6e-06 ref|XP_002302905.1| nbs-lrr resistance protein [Populus trichoca... 56 6e-06 ref|XP_002302904.1| cc-nbs-lrr resistance protein [Populus trich... 56 6e-06 ref|XP_002337425.1| NBS resistance protein [Populus trichocarpa] 56 6e-06 ref|XP_002336233.1| cc-nbs-lrr resistance protein [Populus trich... 56 6e-06 ref|XP_006478603.1| PREDICTED: putative disease resistance prote... 55 7e-06 ref|XP_006442837.1| hypothetical protein CICLE_v100189572mg [Cit... 55 7e-06 emb|CBI40026.3| unnamed protein product [Vitis vinifera] 55 7e-06 >ref|XP_006383347.1| hypothetical protein POPTR_0005s147101g, partial [Populus trichocarpa] gi|550338956|gb|ERP61144.1| hypothetical protein POPTR_0005s147101g, partial [Populus trichocarpa] Length = 913 Score = 57.8 bits (138), Expect = 1e-06 Identities = 23/51 (45%), Positives = 35/51 (68%) Frame = -2 Query: 153 DDEWMILAHSDVCELRVFKEENFPLFRLNHPNLASHLKKCFAYCSLFPREY 1 +DEW+ + S++ +LR P RL++ NL HLK+CFAYCS+FP++Y Sbjct: 219 EDEWLCVKESEIWDLRQEGSTILPALRLSYINLPPHLKQCFAYCSIFPKDY 269 >ref|XP_002301714.1| NBS resistance protein [Populus trichocarpa] Length = 171 Score = 57.8 bits (138), Expect = 1e-06 Identities = 23/51 (45%), Positives = 35/51 (68%) Frame = -2 Query: 153 DDEWMILAHSDVCELRVFKEENFPLFRLNHPNLASHLKKCFAYCSLFPREY 1 +DEW+ + S++ +LR P RL++ NL HLK+CFAYCS+FP++Y Sbjct: 104 EDEWLCVKESEIWDLRQEGSTILPALRLSYINLPPHLKQCFAYCSIFPKDY 154 >ref|XP_002301713.1| nbs-lrr resistance protein [Populus trichocarpa] Length = 1109 Score = 57.8 bits (138), Expect = 1e-06 Identities = 23/51 (45%), Positives = 35/51 (68%) Frame = -2 Query: 153 DDEWMILAHSDVCELRVFKEENFPLFRLNHPNLASHLKKCFAYCSLFPREY 1 +DEW+ + S++ +LR P RL++ NL HLK+CFAYCS+FP++Y Sbjct: 388 EDEWLCVKESEIWDLRQEGSTILPALRLSYINLPPHLKQCFAYCSIFPKDY 438 >ref|XP_006372537.1| hypothetical protein POPTR_0017s02570g [Populus trichocarpa] gi|550319165|gb|ERP50334.1| hypothetical protein POPTR_0017s02570g [Populus trichocarpa] Length = 1067 Score = 57.4 bits (137), Expect = 2e-06 Identities = 21/51 (41%), Positives = 37/51 (72%) Frame = -2 Query: 153 DDEWMILAHSDVCELRVFKEENFPLFRLNHPNLASHLKKCFAYCSLFPREY 1 +D+W+ + S++ +LR E P RL++ NL+ HLK+CFAYC++FP+++ Sbjct: 379 EDQWIAVKESEIWDLREEANEILPALRLSYTNLSPHLKQCFAYCAIFPKDH 429 >ref|XP_006388711.1| hypothetical protein POPTR_0115s00270g [Populus trichocarpa] gi|550310693|gb|ERP47625.1| hypothetical protein POPTR_0115s00270g [Populus trichocarpa] Length = 1064 Score = 57.4 bits (137), Expect = 2e-06 Identities = 21/51 (41%), Positives = 37/51 (72%) Frame = -2 Query: 153 DDEWMILAHSDVCELRVFKEENFPLFRLNHPNLASHLKKCFAYCSLFPREY 1 +D+W+ + S++ +LR E P RL++ NL+ HLK+CFAYC++FP+++ Sbjct: 376 EDQWIAVKESEIWDLREDASEILPALRLSYTNLSPHLKQCFAYCAIFPKDH 426 >ref|XP_006372507.1| hypothetical protein POPTR_0017s02290g [Populus trichocarpa] gi|550319133|gb|ERP50304.1| hypothetical protein POPTR_0017s02290g [Populus trichocarpa] Length = 1082 Score = 56.6 bits (135), Expect = 3e-06 Identities = 21/50 (42%), Positives = 36/50 (72%) Frame = -2 Query: 153 DDEWMILAHSDVCELRVFKEENFPLFRLNHPNLASHLKKCFAYCSLFPRE 4 +D+W+ + S++ +LR E P RL++ NL+ HLK+CFAYC++FP++ Sbjct: 379 EDQWIAVKESEIWDLREEASEILPALRLSYTNLSPHLKQCFAYCAIFPKD 428 >ref|XP_006388567.1| hypothetical protein POPTR_0154s00220g [Populus trichocarpa] gi|550310410|gb|ERP47481.1| hypothetical protein POPTR_0154s00220g [Populus trichocarpa] Length = 1073 Score = 56.6 bits (135), Expect = 3e-06 Identities = 21/50 (42%), Positives = 36/50 (72%) Frame = -2 Query: 153 DDEWMILAHSDVCELRVFKEENFPLFRLNHPNLASHLKKCFAYCSLFPRE 4 +D+W+ + S++ +LR E P RL++ NL+ HLK+CFAYC++FP++ Sbjct: 379 EDQWIAVKESEIWDLREEANEILPALRLSYTNLSPHLKQCFAYCAIFPKD 428 >ref|XP_002335004.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Length = 851 Score = 56.6 bits (135), Expect = 3e-06 Identities = 21/50 (42%), Positives = 36/50 (72%) Frame = -2 Query: 153 DDEWMILAHSDVCELRVFKEENFPLFRLNHPNLASHLKKCFAYCSLFPRE 4 +D+W+ + S++ +LR E P RL++ NL+ HLK+CFAYC++FP++ Sbjct: 379 EDQWIAVKESEIWDLREEANEILPALRLSYTNLSPHLKQCFAYCAIFPKD 428 >ref|XP_006372509.1| hypothetical protein POPTR_0017s02310g, partial [Populus trichocarpa] gi|550319135|gb|ERP50306.1| hypothetical protein POPTR_0017s02310g, partial [Populus trichocarpa] Length = 465 Score = 55.8 bits (133), Expect = 6e-06 Identities = 20/51 (39%), Positives = 37/51 (72%) Frame = -2 Query: 153 DDEWMILAHSDVCELRVFKEENFPLFRLNHPNLASHLKKCFAYCSLFPREY 1 +D+W+ + S++ +LR + P RL++ NL+ HLK+CFAYC++FP+++ Sbjct: 379 EDQWIAVKESEIWDLREEASKILPALRLSYTNLSPHLKQCFAYCAIFPKDH 429 >ref|XP_006372496.1| hypothetical protein POPTR_0017s02200g [Populus trichocarpa] gi|550319122|gb|ERP50293.1| hypothetical protein POPTR_0017s02200g [Populus trichocarpa] Length = 1131 Score = 55.8 bits (133), Expect = 6e-06 Identities = 21/51 (41%), Positives = 37/51 (72%) Frame = -2 Query: 153 DDEWMILAHSDVCELRVFKEENFPLFRLNHPNLASHLKKCFAYCSLFPREY 1 +DEW+ + S++ +LR E P RL++ NL+ HLK+CFA+C++FP+++ Sbjct: 379 EDEWIKVKKSEIWDLREEASEILPALRLSYTNLSPHLKQCFAFCAIFPKDH 429 >ref|XP_006388570.1| hypothetical protein POPTR_0154s00250g [Populus trichocarpa] gi|550310413|gb|ERP47484.1| hypothetical protein POPTR_0154s00250g [Populus trichocarpa] Length = 1024 Score = 55.8 bits (133), Expect = 6e-06 Identities = 20/51 (39%), Positives = 37/51 (72%) Frame = -2 Query: 153 DDEWMILAHSDVCELRVFKEENFPLFRLNHPNLASHLKKCFAYCSLFPREY 1 +D+W+ + S++ +LR + P RL++ NL+ HLK+CFAYC++FP+++ Sbjct: 350 EDQWIAVKESEIWDLREEASKILPALRLSYTNLSPHLKQCFAYCAIFPKDH 400 >ref|XP_006388382.1| hypothetical protein POPTR_0202s002003g, partial [Populus trichocarpa] gi|550310104|gb|ERP47296.1| hypothetical protein POPTR_0202s002003g, partial [Populus trichocarpa] Length = 411 Score = 55.8 bits (133), Expect = 6e-06 Identities = 20/51 (39%), Positives = 37/51 (72%) Frame = -2 Query: 153 DDEWMILAHSDVCELRVFKEENFPLFRLNHPNLASHLKKCFAYCSLFPREY 1 +D+W+ + S++ +LR + P RL++ NL+ HLK+CFAYC++FP+++ Sbjct: 347 EDQWIAVKESEIWDLREEASKILPALRLSYTNLSPHLKQCFAYCAIFPKDH 397 >ref|XP_002302910.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Length = 1131 Score = 55.8 bits (133), Expect = 6e-06 Identities = 21/51 (41%), Positives = 37/51 (72%) Frame = -2 Query: 153 DDEWMILAHSDVCELRVFKEENFPLFRLNHPNLASHLKKCFAYCSLFPREY 1 +DEW+ + S++ +LR E P RL++ NL+ HLK+CFA+C++FP+++ Sbjct: 379 EDEWIKVKKSEIWDLREEASEILPALRLSYTNLSPHLKQCFAFCAIFPKDH 429 >ref|XP_002302905.1| nbs-lrr resistance protein [Populus trichocarpa] Length = 968 Score = 55.8 bits (133), Expect = 6e-06 Identities = 20/51 (39%), Positives = 37/51 (72%) Frame = -2 Query: 153 DDEWMILAHSDVCELRVFKEENFPLFRLNHPNLASHLKKCFAYCSLFPREY 1 +D+W+ + S++ +LR + P RL++ NL+ HLK+CFAYC++FP+++ Sbjct: 264 EDQWIAVKESEIWDLREEASKILPALRLSYTNLSPHLKQCFAYCAIFPKDH 314 >ref|XP_002302904.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|566210842|ref|XP_006372497.1| hypothetical protein POPTR_0017s02200g [Populus trichocarpa] gi|550319123|gb|ERP50294.1| hypothetical protein POPTR_0017s02200g [Populus trichocarpa] Length = 944 Score = 55.8 bits (133), Expect = 6e-06 Identities = 21/51 (41%), Positives = 37/51 (72%) Frame = -2 Query: 153 DDEWMILAHSDVCELRVFKEENFPLFRLNHPNLASHLKKCFAYCSLFPREY 1 +DEW+ + S++ +LR E P RL++ NL+ HLK+CFA+C++FP+++ Sbjct: 379 EDEWIKVKKSEIWDLREEASEILPALRLSYTNLSPHLKQCFAFCAIFPKDH 429 >ref|XP_002337425.1| NBS resistance protein [Populus trichocarpa] Length = 248 Score = 55.8 bits (133), Expect = 6e-06 Identities = 20/51 (39%), Positives = 37/51 (72%) Frame = -2 Query: 153 DDEWMILAHSDVCELRVFKEENFPLFRLNHPNLASHLKKCFAYCSLFPREY 1 +D+W+ + S++ +LR + P RL++ NL+ HLK+CFAYC++FP+++ Sbjct: 161 EDQWIAVKESEIWDLREEASKILPALRLSYTNLSPHLKQCFAYCAIFPKDH 211 >ref|XP_002336233.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Length = 808 Score = 55.8 bits (133), Expect = 6e-06 Identities = 20/51 (39%), Positives = 37/51 (72%) Frame = -2 Query: 153 DDEWMILAHSDVCELRVFKEENFPLFRLNHPNLASHLKKCFAYCSLFPREY 1 +D+W+ + S++ +LR + P RL++ NL+ HLK+CFAYC++FP+++ Sbjct: 379 EDQWIAVKESEIWDLREEASKILPALRLSYTNLSPHLKQCFAYCAIFPKDH 429 >ref|XP_006478603.1| PREDICTED: putative disease resistance protein RGA3-like [Citrus sinensis] Length = 1051 Score = 55.5 bits (132), Expect = 7e-06 Identities = 22/50 (44%), Positives = 34/50 (68%) Frame = -2 Query: 150 DEWMILAHSDVCELRVFKEENFPLFRLNHPNLASHLKKCFAYCSLFPREY 1 +EW+ +A D+ L FK P+ + ++ NL HLK+CFAYCS+FP++Y Sbjct: 355 EEWLSVADCDLWTLLEFKSHVLPVLKRSYDNLPWHLKQCFAYCSIFPKDY 404 >ref|XP_006442837.1| hypothetical protein CICLE_v100189572mg [Citrus clementina] gi|557545099|gb|ESR56077.1| hypothetical protein CICLE_v100189572mg [Citrus clementina] Length = 773 Score = 55.5 bits (132), Expect = 7e-06 Identities = 22/50 (44%), Positives = 34/50 (68%) Frame = -2 Query: 150 DEWMILAHSDVCELRVFKEENFPLFRLNHPNLASHLKKCFAYCSLFPREY 1 +EW+ +A D+ L FK P+ + ++ NL HLK+CFAYCS+FP++Y Sbjct: 96 EEWLSVADCDLWTLLEFKSHVLPVLKRSYDNLPWHLKQCFAYCSIFPKDY 145 >emb|CBI40026.3| unnamed protein product [Vitis vinifera] Length = 931 Score = 55.5 bits (132), Expect = 7e-06 Identities = 22/50 (44%), Positives = 36/50 (72%) Frame = -2 Query: 150 DEWMILAHSDVCELRVFKEENFPLFRLNHPNLASHLKKCFAYCSLFPREY 1 ++W ++ +D+CE+ K FP +L++ +L SH+K+CFAYCSLFP+ Y Sbjct: 129 NKWQNISANDICEVE--KHNIFPALKLSYDHLPSHIKQCFAYCSLFPKGY 176