BLASTX nr result
ID: Achyranthes23_contig00013725
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00013725 (452 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB77047.1| hypothetical protein L484_014173 [Morus notabilis] 109 3e-22 ref|XP_006475026.1| PREDICTED: proline synthase co-transcribed b... 108 7e-22 ref|XP_006452430.1| hypothetical protein CICLE_v10009301mg [Citr... 108 7e-22 ref|XP_002278892.1| PREDICTED: proline synthase co-transcribed b... 108 7e-22 emb|CAN80917.1| hypothetical protein VITISV_024616 [Vitis vinifera] 108 7e-22 ref|XP_006843820.1| hypothetical protein AMTR_s00007p00257060 [A... 105 6e-21 gb|EOY28769.1| Pyridoxal phosphate-dependent enzyme [Theobroma c... 105 6e-21 ref|XP_002529455.1| proline synthetase associated protein, putat... 105 6e-21 ref|XP_004248334.1| PREDICTED: proline synthase co-transcribed b... 105 8e-21 ref|XP_002518437.1| proline synthetase associated protein, putat... 105 8e-21 ref|XP_006383876.1| hypothetical protein POPTR_0004s00800g [Popu... 104 1e-20 ref|XP_002331519.1| predicted protein [Populus trichocarpa] 104 1e-20 ref|XP_006352515.1| PREDICTED: proline synthase co-transcribed b... 103 2e-20 ref|XP_004293314.1| PREDICTED: proline synthase co-transcribed b... 103 2e-20 ref|XP_002263767.2| PREDICTED: proline synthase co-transcribed b... 103 2e-20 emb|CBI23205.3| unnamed protein product [Vitis vinifera] 103 2e-20 gb|ESW18506.1| hypothetical protein PHAVU_006G047100g [Phaseolus... 102 4e-20 ref|XP_006284354.1| hypothetical protein CARUB_v10005526mg, part... 102 4e-20 gb|EOY12271.1| Pyridoxal phosphate-dependent enzyme, YBL036C typ... 102 5e-20 gb|EXB63289.1| hypothetical protein L484_012479 [Morus notabilis] 102 7e-20 >gb|EXB77047.1| hypothetical protein L484_014173 [Morus notabilis] Length = 316 Score = 109 bits (273), Expect = 3e-22 Identities = 53/57 (92%), Positives = 53/57 (92%) Frame = -2 Query: 451 TLLNCRGEVCKALGIAEGQCELSMGMSGDFEQAIEMGSTNVRIGSTIFGPREYPKKQ 281 TL NCR EVCKALGIAE QCELSMGMSGDFE AIEMGSTNVRIGSTIFGPREYPKKQ Sbjct: 259 TLANCRSEVCKALGIAEEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGPREYPKKQ 315 >ref|XP_006475026.1| PREDICTED: proline synthase co-transcribed bacterial homolog protein-like [Citrus sinensis] Length = 245 Score = 108 bits (270), Expect = 7e-22 Identities = 52/57 (91%), Positives = 54/57 (94%) Frame = -2 Query: 451 TLLNCRGEVCKALGIAEGQCELSMGMSGDFEQAIEMGSTNVRIGSTIFGPREYPKKQ 281 TLLNCR EVCKALG+AE QCELSMGMSGDFEQAIEMGST+VRIGSTIFGPREY KKQ Sbjct: 187 TLLNCRAEVCKALGMAEDQCELSMGMSGDFEQAIEMGSTSVRIGSTIFGPREYAKKQ 243 >ref|XP_006452430.1| hypothetical protein CICLE_v10009301mg [Citrus clementina] gi|557555656|gb|ESR65670.1| hypothetical protein CICLE_v10009301mg [Citrus clementina] Length = 245 Score = 108 bits (270), Expect = 7e-22 Identities = 52/57 (91%), Positives = 54/57 (94%) Frame = -2 Query: 451 TLLNCRGEVCKALGIAEGQCELSMGMSGDFEQAIEMGSTNVRIGSTIFGPREYPKKQ 281 TLLNCR EVCKALG+AE QCELSMGMSGDFEQAIEMGST+VRIGSTIFGPREY KKQ Sbjct: 187 TLLNCRAEVCKALGMAEDQCELSMGMSGDFEQAIEMGSTSVRIGSTIFGPREYAKKQ 243 >ref|XP_002278892.1| PREDICTED: proline synthase co-transcribed bacterial homolog protein [Vitis vinifera] gi|297737470|emb|CBI26671.3| unnamed protein product [Vitis vinifera] Length = 245 Score = 108 bits (270), Expect = 7e-22 Identities = 52/56 (92%), Positives = 54/56 (96%) Frame = -2 Query: 448 LLNCRGEVCKALGIAEGQCELSMGMSGDFEQAIEMGSTNVRIGSTIFGPREYPKKQ 281 LLNCR EVCKALG+AE QCELSMGMSGDFEQAIEMGSTNVRIGSTIFGPREYPKK+ Sbjct: 188 LLNCRIEVCKALGMAEEQCELSMGMSGDFEQAIEMGSTNVRIGSTIFGPREYPKKE 243 >emb|CAN80917.1| hypothetical protein VITISV_024616 [Vitis vinifera] Length = 245 Score = 108 bits (270), Expect = 7e-22 Identities = 52/56 (92%), Positives = 54/56 (96%) Frame = -2 Query: 448 LLNCRGEVCKALGIAEGQCELSMGMSGDFEQAIEMGSTNVRIGSTIFGPREYPKKQ 281 LLNCR EVCKALG+AE QCELSMGMSGDFEQAIEMGSTNVRIGSTIFGPREYPKK+ Sbjct: 188 LLNCRIEVCKALGMAEEQCELSMGMSGDFEQAIEMGSTNVRIGSTIFGPREYPKKE 243 >ref|XP_006843820.1| hypothetical protein AMTR_s00007p00257060 [Amborella trichopoda] gi|548846188|gb|ERN05495.1| hypothetical protein AMTR_s00007p00257060 [Amborella trichopoda] Length = 246 Score = 105 bits (262), Expect = 6e-21 Identities = 50/56 (89%), Positives = 52/56 (92%) Frame = -2 Query: 448 LLNCRGEVCKALGIAEGQCELSMGMSGDFEQAIEMGSTNVRIGSTIFGPREYPKKQ 281 L+ CR EVCKALGIAE QCELSMGMSGDFEQAIEMGSTNVRIGSTIFG REYPKK+ Sbjct: 188 LVECRNEVCKALGIAEAQCELSMGMSGDFEQAIEMGSTNVRIGSTIFGAREYPKKE 243 >gb|EOY28769.1| Pyridoxal phosphate-dependent enzyme [Theobroma cacao] Length = 266 Score = 105 bits (262), Expect = 6e-21 Identities = 51/56 (91%), Positives = 51/56 (91%) Frame = -2 Query: 451 TLLNCRGEVCKALGIAEGQCELSMGMSGDFEQAIEMGSTNVRIGSTIFGPREYPKK 284 TL NCR EVCKALGI E QCELSMGMSGDFEQAIEMGSTNVRIGSTIFG REYPKK Sbjct: 210 TLANCRSEVCKALGIPEEQCELSMGMSGDFEQAIEMGSTNVRIGSTIFGAREYPKK 265 >ref|XP_002529455.1| proline synthetase associated protein, putative [Ricinus communis] gi|223531071|gb|EEF32921.1| proline synthetase associated protein, putative [Ricinus communis] Length = 245 Score = 105 bits (262), Expect = 6e-21 Identities = 50/56 (89%), Positives = 52/56 (92%) Frame = -2 Query: 448 LLNCRGEVCKALGIAEGQCELSMGMSGDFEQAIEMGSTNVRIGSTIFGPREYPKKQ 281 L NCR EVCKALG+AE CELSMGMSGDFEQAIEMGSTNVR+GSTIFGPREYPKKQ Sbjct: 188 LSNCRLEVCKALGMAEDHCELSMGMSGDFEQAIEMGSTNVRVGSTIFGPREYPKKQ 243 >ref|XP_004248334.1| PREDICTED: proline synthase co-transcribed bacterial homolog protein-like [Solanum lycopersicum] Length = 243 Score = 105 bits (261), Expect = 8e-21 Identities = 50/57 (87%), Positives = 52/57 (91%) Frame = -2 Query: 451 TLLNCRGEVCKALGIAEGQCELSMGMSGDFEQAIEMGSTNVRIGSTIFGPREYPKKQ 281 TLLNCR EVCK LG+AE +CELSMGMS DFE AIEMGSTNVRIGSTIFGPREYPKKQ Sbjct: 187 TLLNCRTEVCKVLGMAESRCELSMGMSSDFELAIEMGSTNVRIGSTIFGPREYPKKQ 243 >ref|XP_002518437.1| proline synthetase associated protein, putative [Ricinus communis] gi|223542282|gb|EEF43824.1| proline synthetase associated protein, putative [Ricinus communis] Length = 270 Score = 105 bits (261), Expect = 8e-21 Identities = 50/57 (87%), Positives = 51/57 (89%) Frame = -2 Query: 451 TLLNCRGEVCKALGIAEGQCELSMGMSGDFEQAIEMGSTNVRIGSTIFGPREYPKKQ 281 TL NCR EVCK LGI E QCELSMGMS DFEQAIEMGSTNVRIGSTIFGPREYPKK+ Sbjct: 214 TLANCRSEVCKTLGIPEEQCELSMGMSNDFEQAIEMGSTNVRIGSTIFGPREYPKKK 270 >ref|XP_006383876.1| hypothetical protein POPTR_0004s00800g [Populus trichocarpa] gi|550340024|gb|ERP61673.1| hypothetical protein POPTR_0004s00800g [Populus trichocarpa] Length = 272 Score = 104 bits (260), Expect = 1e-20 Identities = 50/56 (89%), Positives = 51/56 (91%) Frame = -2 Query: 448 LLNCRGEVCKALGIAEGQCELSMGMSGDFEQAIEMGSTNVRIGSTIFGPREYPKKQ 281 L NCR EVCKALGI E QCELSMGMS DFEQAIEMGSTNVRIGSTIFGPREYPKK+ Sbjct: 217 LANCRSEVCKALGIPEEQCELSMGMSNDFEQAIEMGSTNVRIGSTIFGPREYPKKK 272 >ref|XP_002331519.1| predicted protein [Populus trichocarpa] Length = 238 Score = 104 bits (260), Expect = 1e-20 Identities = 50/56 (89%), Positives = 51/56 (91%) Frame = -2 Query: 448 LLNCRGEVCKALGIAEGQCELSMGMSGDFEQAIEMGSTNVRIGSTIFGPREYPKKQ 281 L NCR EVCKALGI E QCELSMGMS DFEQAIEMGSTNVRIGSTIFGPREYPKK+ Sbjct: 183 LANCRSEVCKALGIPEEQCELSMGMSNDFEQAIEMGSTNVRIGSTIFGPREYPKKK 238 >ref|XP_006352515.1| PREDICTED: proline synthase co-transcribed bacterial homolog protein-like [Solanum tuberosum] Length = 243 Score = 103 bits (258), Expect = 2e-20 Identities = 49/57 (85%), Positives = 52/57 (91%) Frame = -2 Query: 451 TLLNCRGEVCKALGIAEGQCELSMGMSGDFEQAIEMGSTNVRIGSTIFGPREYPKKQ 281 TLLNCR EVCK LG+AE +CELSMGMS DFE AIEMGSTNVRIGSTIFGPREYPK+Q Sbjct: 187 TLLNCRTEVCKVLGMAESRCELSMGMSSDFELAIEMGSTNVRIGSTIFGPREYPKRQ 243 >ref|XP_004293314.1| PREDICTED: proline synthase co-transcribed bacterial homolog protein-like [Fragaria vesca subsp. vesca] Length = 246 Score = 103 bits (258), Expect = 2e-20 Identities = 50/57 (87%), Positives = 51/57 (89%) Frame = -2 Query: 451 TLLNCRGEVCKALGIAEGQCELSMGMSGDFEQAIEMGSTNVRIGSTIFGPREYPKKQ 281 TL NCR EVCKALGI +CELSMGMS DFEQAIEMGSTNVRIGSTIFGPREYPKKQ Sbjct: 188 TLANCRAEVCKALGIPVEKCELSMGMSADFEQAIEMGSTNVRIGSTIFGPREYPKKQ 244 >ref|XP_002263767.2| PREDICTED: proline synthase co-transcribed bacterial homolog protein-like [Vitis vinifera] Length = 264 Score = 103 bits (258), Expect = 2e-20 Identities = 50/57 (87%), Positives = 51/57 (89%) Frame = -2 Query: 451 TLLNCRGEVCKALGIAEGQCELSMGMSGDFEQAIEMGSTNVRIGSTIFGPREYPKKQ 281 TL NCR EVCK+LGI E QCELSMGMSGDFE AIEMGSTNVRIGSTIFG REYPKKQ Sbjct: 206 TLANCRSEVCKSLGITEEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPKKQ 262 >emb|CBI23205.3| unnamed protein product [Vitis vinifera] Length = 311 Score = 103 bits (258), Expect = 2e-20 Identities = 50/57 (87%), Positives = 51/57 (89%) Frame = -2 Query: 451 TLLNCRGEVCKALGIAEGQCELSMGMSGDFEQAIEMGSTNVRIGSTIFGPREYPKKQ 281 TL NCR EVCK+LGI E QCELSMGMSGDFE AIEMGSTNVRIGSTIFG REYPKKQ Sbjct: 253 TLANCRSEVCKSLGITEEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPKKQ 309 >gb|ESW18506.1| hypothetical protein PHAVU_006G047100g [Phaseolus vulgaris] Length = 245 Score = 102 bits (255), Expect = 4e-20 Identities = 49/57 (85%), Positives = 51/57 (89%) Frame = -2 Query: 451 TLLNCRGEVCKALGIAEGQCELSMGMSGDFEQAIEMGSTNVRIGSTIFGPREYPKKQ 281 TL NCR EVCKAL + E QCELSMGMSGDFE AIEMGSTNVR+GSTIFGPREYPKKQ Sbjct: 188 TLSNCRSEVCKALEMPEEQCELSMGMSGDFELAIEMGSTNVRVGSTIFGPREYPKKQ 244 >ref|XP_006284354.1| hypothetical protein CARUB_v10005526mg, partial [Capsella rubella] gi|482553059|gb|EOA17252.1| hypothetical protein CARUB_v10005526mg, partial [Capsella rubella] Length = 262 Score = 102 bits (255), Expect = 4e-20 Identities = 49/56 (87%), Positives = 52/56 (92%) Frame = -2 Query: 451 TLLNCRGEVCKALGIAEGQCELSMGMSGDFEQAIEMGSTNVRIGSTIFGPREYPKK 284 TL NC+ +VCKALG+AE Q ELSMGMSGDFEQAIEMGSTNVRIGSTIFGPREYPKK Sbjct: 205 TLSNCKADVCKALGMAEDQFELSMGMSGDFEQAIEMGSTNVRIGSTIFGPREYPKK 260 >gb|EOY12271.1| Pyridoxal phosphate-dependent enzyme, YBL036C type isoform 1 [Theobroma cacao] Length = 259 Score = 102 bits (254), Expect = 5e-20 Identities = 48/56 (85%), Positives = 52/56 (92%) Frame = -2 Query: 451 TLLNCRGEVCKALGIAEGQCELSMGMSGDFEQAIEMGSTNVRIGSTIFGPREYPKK 284 TL NCR EVCKALG+AE +CELSMGMSGDFEQAIEMGSTNVR+GSTIFGPR+Y KK Sbjct: 201 TLSNCRVEVCKALGMAEDECELSMGMSGDFEQAIEMGSTNVRVGSTIFGPRDYSKK 256 >gb|EXB63289.1| hypothetical protein L484_012479 [Morus notabilis] Length = 243 Score = 102 bits (253), Expect = 7e-20 Identities = 50/57 (87%), Positives = 51/57 (89%) Frame = -2 Query: 451 TLLNCRGEVCKALGIAEGQCELSMGMSGDFEQAIEMGSTNVRIGSTIFGPREYPKKQ 281 TLLN R EVCKALG+ E QCELSMGMSGDFEQAIE GSTNVRIGSTIFGPREY KKQ Sbjct: 187 TLLNSRTEVCKALGLTEEQCELSMGMSGDFEQAIETGSTNVRIGSTIFGPREYAKKQ 243