BLASTX nr result
ID: Achyranthes23_contig00013677
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00013677 (368 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004513238.1| PREDICTED: anthranilate synthase component I... 91 2e-16 ref|XP_004514367.1| PREDICTED: anthranilate synthase component I... 89 8e-16 ref|XP_004514366.1| PREDICTED: anthranilate synthase component I... 89 8e-16 gb|EMJ23707.1| hypothetical protein PRUPE_ppa009800mg [Prunus pe... 87 2e-15 gb|EXC05041.1| hypothetical protein L484_019289 [Morus notabilis] 86 4e-15 ref|XP_003547656.1| PREDICTED: anthranilate synthase component 2... 86 4e-15 ref|XP_004297400.1| PREDICTED: anthranilate synthase component I... 86 5e-15 ref|XP_002314761.1| anthranilate synthase beta subunit 1 family ... 85 9e-15 ref|XP_003529236.1| PREDICTED: anthranilate synthase component 2... 85 1e-14 ref|XP_002527548.1| Anthranilate synthase component II, putative... 85 1e-14 gb|ACJ84848.1| unknown [Medicago truncatula] gi|388498572|gb|AFK... 85 1e-14 ref|NP_200597.1| glutamine amidotransferase type 1 family protei... 84 1e-14 ref|XP_006469298.1| PREDICTED: anthranilate synthase component 2... 84 1e-14 ref|XP_006448093.1| hypothetical protein CICLE_v100161761mg, par... 84 1e-14 ref|XP_006304070.1| hypothetical protein CARUB_v10009928mg [Caps... 84 1e-14 ref|XP_002890696.1| hypothetical protein ARALYDRAFT_472860 [Arab... 84 1e-14 gb|AAM65944.1| anthranilate synthase beta chain [Arabidopsis tha... 84 1e-14 ref|XP_004142292.1| PREDICTED: anthranilate synthase component I... 84 2e-14 ref|NP_173893.1| anthranilate synthase beta subunit 1 [Arabidops... 84 2e-14 ref|NP_001185092.1| anthranilate synthase beta subunit 1 [Arabid... 84 2e-14 >ref|XP_004513238.1| PREDICTED: anthranilate synthase component II-like [Cicer arietinum] Length = 273 Score = 90.5 bits (223), Expect = 2e-16 Identities = 38/49 (77%), Positives = 45/49 (91%) Frame = -3 Query: 366 AWTEDGLVMAARHKEYRYLQAVQFHPESVLTPEGMTIIKNFIKMIESEE 220 AWTEDGL+MAARHK+YRYLQ VQFHPES++TPEGMTI+ NF+K+IE E Sbjct: 221 AWTEDGLIMAARHKKYRYLQGVQFHPESIITPEGMTIVHNFVKLIEKRE 269 >ref|XP_004514367.1| PREDICTED: anthranilate synthase component II-like isoform X2 [Cicer arietinum] Length = 262 Score = 88.6 bits (218), Expect = 8e-16 Identities = 37/49 (75%), Positives = 45/49 (91%) Frame = -3 Query: 366 AWTEDGLVMAARHKEYRYLQAVQFHPESVLTPEGMTIIKNFIKMIESEE 220 AWTEDGL+MAARHK+YR+LQ VQFHPES++TPEGMTI+ NF+K+IE E Sbjct: 210 AWTEDGLIMAARHKKYRHLQGVQFHPESIITPEGMTIVHNFVKLIEKRE 258 >ref|XP_004514366.1| PREDICTED: anthranilate synthase component II-like isoform X1 [Cicer arietinum] Length = 273 Score = 88.6 bits (218), Expect = 8e-16 Identities = 37/49 (75%), Positives = 45/49 (91%) Frame = -3 Query: 366 AWTEDGLVMAARHKEYRYLQAVQFHPESVLTPEGMTIIKNFIKMIESEE 220 AWTEDGL+MAARHK+YR+LQ VQFHPES++TPEGMTI+ NF+K+IE E Sbjct: 221 AWTEDGLIMAARHKKYRHLQGVQFHPESIITPEGMTIVHNFVKLIEKRE 269 >gb|EMJ23707.1| hypothetical protein PRUPE_ppa009800mg [Prunus persica] Length = 277 Score = 87.0 bits (214), Expect = 2e-15 Identities = 37/51 (72%), Positives = 46/51 (90%) Frame = -3 Query: 366 AWTEDGLVMAARHKEYRYLQAVQFHPESVLTPEGMTIIKNFIKMIESEETE 214 AWTEDGL+MAARHK+YR+LQ VQFHPES++T EG TI++NFIK+IE E+E Sbjct: 224 AWTEDGLIMAARHKKYRHLQGVQFHPESIITSEGKTIVRNFIKLIEKRESE 274 >gb|EXC05041.1| hypothetical protein L484_019289 [Morus notabilis] Length = 273 Score = 86.3 bits (212), Expect = 4e-15 Identities = 38/51 (74%), Positives = 45/51 (88%) Frame = -3 Query: 366 AWTEDGLVMAARHKEYRYLQAVQFHPESVLTPEGMTIIKNFIKMIESEETE 214 AWTEDGLVMAARHK+YRYLQ VQFHPES++T EG +++NFIKMIE E+E Sbjct: 220 AWTEDGLVMAARHKKYRYLQGVQFHPESIITTEGKGMVRNFIKMIERRESE 270 >ref|XP_003547656.1| PREDICTED: anthranilate synthase component 2-like isoform 1 [Glycine max] Length = 278 Score = 86.3 bits (212), Expect = 4e-15 Identities = 35/49 (71%), Positives = 45/49 (91%) Frame = -3 Query: 366 AWTEDGLVMAARHKEYRYLQAVQFHPESVLTPEGMTIIKNFIKMIESEE 220 AWTEDGL+MAARHK+Y++LQ VQFHPES++TPEG TI++NF+K+IE E Sbjct: 226 AWTEDGLIMAARHKKYKHLQGVQFHPESIITPEGKTIVRNFVKLIEKRE 274 >ref|XP_004297400.1| PREDICTED: anthranilate synthase component II-like [Fragaria vesca subsp. vesca] Length = 277 Score = 85.9 bits (211), Expect = 5e-15 Identities = 36/51 (70%), Positives = 45/51 (88%) Frame = -3 Query: 366 AWTEDGLVMAARHKEYRYLQAVQFHPESVLTPEGMTIIKNFIKMIESEETE 214 AWTEDGL+MAARHK+Y+YLQ VQFHPES++T EG TI+ NF+K+IE E+E Sbjct: 224 AWTEDGLIMAARHKKYKYLQGVQFHPESIITSEGRTIVGNFVKLIEKSESE 274 >ref|XP_002314761.1| anthranilate synthase beta subunit 1 family protein [Populus trichocarpa] gi|222863801|gb|EEF00932.1| anthranilate synthase beta subunit 1 family protein [Populus trichocarpa] Length = 276 Score = 85.1 bits (209), Expect = 9e-15 Identities = 35/51 (68%), Positives = 46/51 (90%) Frame = -3 Query: 366 AWTEDGLVMAARHKEYRYLQAVQFHPESVLTPEGMTIIKNFIKMIESEETE 214 AWTEDGL+MAARH++Y++LQ VQFHPES++T EG TI++NFIKM+E +E E Sbjct: 223 AWTEDGLIMAARHRKYKHLQGVQFHPESIITSEGKTIVRNFIKMVERKEAE 273 >ref|XP_003529236.1| PREDICTED: anthranilate synthase component 2-like [Glycine max] Length = 276 Score = 84.7 bits (208), Expect = 1e-14 Identities = 35/49 (71%), Positives = 44/49 (89%) Frame = -3 Query: 366 AWTEDGLVMAARHKEYRYLQAVQFHPESVLTPEGMTIIKNFIKMIESEE 220 AWTEDGL+MAARHK+Y++LQ VQFHPES++TPEG TI+ NF+K+IE E Sbjct: 224 AWTEDGLIMAARHKKYKHLQGVQFHPESIITPEGKTIVHNFVKLIERSE 272 >ref|XP_002527548.1| Anthranilate synthase component II, putative [Ricinus communis] gi|223533098|gb|EEF34857.1| Anthranilate synthase component II, putative [Ricinus communis] Length = 281 Score = 84.7 bits (208), Expect = 1e-14 Identities = 35/51 (68%), Positives = 46/51 (90%) Frame = -3 Query: 366 AWTEDGLVMAARHKEYRYLQAVQFHPESVLTPEGMTIIKNFIKMIESEETE 214 AWTEDGL+MAARHK+Y++LQ VQFHPES++T EG TI++NFIK++E +E E Sbjct: 228 AWTEDGLIMAARHKKYKHLQGVQFHPESIITSEGKTIVQNFIKLVERKEAE 278 >gb|ACJ84848.1| unknown [Medicago truncatula] gi|388498572|gb|AFK37352.1| unknown [Medicago truncatula] Length = 270 Score = 84.7 bits (208), Expect = 1e-14 Identities = 34/49 (69%), Positives = 45/49 (91%) Frame = -3 Query: 366 AWTEDGLVMAARHKEYRYLQAVQFHPESVLTPEGMTIIKNFIKMIESEE 220 AWTEDGL+MAARHK+YR++Q VQFHPES++TP+G TI+ NF+K+IE +E Sbjct: 218 AWTEDGLIMAARHKKYRHMQGVQFHPESIITPDGKTIVHNFVKLIEKKE 266 >ref|NP_200597.1| glutamine amidotransferase type 1 family protein [Arabidopsis thaliana] gi|9758358|dbj|BAB08859.1| anthranilate synthase beta chain [Arabidopsis thaliana] gi|90186236|gb|ABD91494.1| At5g57890 [Arabidopsis thaliana] gi|332009585|gb|AED96968.1| glutamine amidotransferase type 1 family protein [Arabidopsis thaliana] Length = 273 Score = 84.3 bits (207), Expect = 1e-14 Identities = 34/51 (66%), Positives = 47/51 (92%) Frame = -3 Query: 366 AWTEDGLVMAARHKEYRYLQAVQFHPESVLTPEGMTIIKNFIKMIESEETE 214 AWTEDGLVMAARH++Y+++Q VQFHPES++T EG TI++NFIK++E +E+E Sbjct: 220 AWTEDGLVMAARHRKYKHIQGVQFHPESIITTEGKTIVRNFIKLVEKKESE 270 >ref|XP_006469298.1| PREDICTED: anthranilate synthase component 2-like [Citrus sinensis] Length = 283 Score = 84.3 bits (207), Expect = 1e-14 Identities = 36/53 (67%), Positives = 46/53 (86%) Frame = -3 Query: 366 AWTEDGLVMAARHKEYRYLQAVQFHPESVLTPEGMTIIKNFIKMIESEETEDA 208 AWTEDGL+MAARHK+Y++LQ VQFHPES++T EG TI++NFIKMI +E D+ Sbjct: 229 AWTEDGLIMAARHKKYKHLQGVQFHPESIITTEGKTIVRNFIKMIVRKEAADS 281 >ref|XP_006448093.1| hypothetical protein CICLE_v100161761mg, partial [Citrus clementina] gi|557550704|gb|ESR61333.1| hypothetical protein CICLE_v100161761mg, partial [Citrus clementina] Length = 80 Score = 84.3 bits (207), Expect = 1e-14 Identities = 36/53 (67%), Positives = 46/53 (86%) Frame = -3 Query: 366 AWTEDGLVMAARHKEYRYLQAVQFHPESVLTPEGMTIIKNFIKMIESEETEDA 208 AWTEDGL+MAARHK+Y++LQ VQFHPES++T EG TI++NFIKMI +E D+ Sbjct: 26 AWTEDGLIMAARHKKYKHLQGVQFHPESIITTEGKTIVRNFIKMIVRKEAADS 78 >ref|XP_006304070.1| hypothetical protein CARUB_v10009928mg [Capsella rubella] gi|482572781|gb|EOA36968.1| hypothetical protein CARUB_v10009928mg [Capsella rubella] Length = 286 Score = 84.3 bits (207), Expect = 1e-14 Identities = 34/51 (66%), Positives = 47/51 (92%) Frame = -3 Query: 366 AWTEDGLVMAARHKEYRYLQAVQFHPESVLTPEGMTIIKNFIKMIESEETE 214 AWTEDGLVMAARH++Y+++Q VQFHPES++T EG TI++NFIK++E +E+E Sbjct: 233 AWTEDGLVMAARHRKYKHIQGVQFHPESIITTEGKTIVRNFIKLVEKKESE 283 >ref|XP_002890696.1| hypothetical protein ARALYDRAFT_472860 [Arabidopsis lyrata subsp. lyrata] gi|297336538|gb|EFH66955.1| hypothetical protein ARALYDRAFT_472860 [Arabidopsis lyrata subsp. lyrata] Length = 277 Score = 84.3 bits (207), Expect = 1e-14 Identities = 34/51 (66%), Positives = 47/51 (92%) Frame = -3 Query: 366 AWTEDGLVMAARHKEYRYLQAVQFHPESVLTPEGMTIIKNFIKMIESEETE 214 AWTEDGLVMAARH++Y+++Q VQFHPES++T EG TI++NFIK++E +E+E Sbjct: 224 AWTEDGLVMAARHRKYKHIQGVQFHPESIITTEGKTIVRNFIKLVEKKESE 274 >gb|AAM65944.1| anthranilate synthase beta chain [Arabidopsis thaliana] Length = 273 Score = 84.3 bits (207), Expect = 1e-14 Identities = 34/51 (66%), Positives = 47/51 (92%) Frame = -3 Query: 366 AWTEDGLVMAARHKEYRYLQAVQFHPESVLTPEGMTIIKNFIKMIESEETE 214 AWTEDGLVMAARH++Y+++Q VQFHPES++T EG TI++NFIK++E +E+E Sbjct: 220 AWTEDGLVMAARHRKYKHIQGVQFHPESIITTEGKTIVRNFIKLVEKKESE 270 >ref|XP_004142292.1| PREDICTED: anthranilate synthase component II-like [Cucumis sativus] gi|449513110|ref|XP_004164233.1| PREDICTED: anthranilate synthase component II-like [Cucumis sativus] Length = 276 Score = 84.0 bits (206), Expect = 2e-14 Identities = 35/51 (68%), Positives = 45/51 (88%) Frame = -3 Query: 366 AWTEDGLVMAARHKEYRYLQAVQFHPESVLTPEGMTIIKNFIKMIESEETE 214 AWTEDGL+MAARH +YR+LQ VQFHPES++T EGM I++NF+K+IE +E E Sbjct: 221 AWTEDGLIMAARHSKYRHLQGVQFHPESIITNEGMLIVRNFVKLIEKKERE 271 >ref|NP_173893.1| anthranilate synthase beta subunit 1 [Arabidopsis thaliana] gi|11067285|gb|AAG28813.1|AC079374_16 anthranilate synthase beta subunit [Arabidopsis thaliana] gi|403434|gb|AAA32742.1| anthranilate synthase beta subunit [Arabidopsis thaliana] gi|20466736|gb|AAM20685.1| anthranilate synthase beta subunit [Arabidopsis thaliana] gi|30023756|gb|AAP13411.1| At1g25220 [Arabidopsis thaliana] gi|110741096|dbj|BAE98642.1| hypothetical protein [Arabidopsis thaliana] gi|332192468|gb|AEE30589.1| anthranilate synthase beta subunit 1 [Arabidopsis thaliana] Length = 276 Score = 84.0 bits (206), Expect = 2e-14 Identities = 34/51 (66%), Positives = 47/51 (92%) Frame = -3 Query: 366 AWTEDGLVMAARHKEYRYLQAVQFHPESVLTPEGMTIIKNFIKMIESEETE 214 AWTEDGLVMAARH++Y+++Q VQFHPES++T EG TI++NFIK++E +E+E Sbjct: 223 AWTEDGLVMAARHRKYKHIQGVQFHPESIITTEGKTIVRNFIKIVEKKESE 273 >ref|NP_001185092.1| anthranilate synthase beta subunit 1 [Arabidopsis thaliana] gi|332192469|gb|AEE30590.1| anthranilate synthase beta subunit 1 [Arabidopsis thaliana] Length = 289 Score = 84.0 bits (206), Expect = 2e-14 Identities = 34/51 (66%), Positives = 47/51 (92%) Frame = -3 Query: 366 AWTEDGLVMAARHKEYRYLQAVQFHPESVLTPEGMTIIKNFIKMIESEETE 214 AWTEDGLVMAARH++Y+++Q VQFHPES++T EG TI++NFIK++E +E+E Sbjct: 236 AWTEDGLVMAARHRKYKHIQGVQFHPESIITTEGKTIVRNFIKIVEKKESE 286