BLASTX nr result
ID: Achyranthes23_contig00013378
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00013378 (248 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|P41349.1|FTRC2_SPIOL RecName: Full=Ferredoxin-thioredoxin red... 65 1e-08 >sp|P41349.1|FTRC2_SPIOL RecName: Full=Ferredoxin-thioredoxin reductase catalytic chain, chloroplastic; Short=FTR-C; AltName: Full=B1; AltName: Full=Ferredoxin-thioredoxin reductase subunit B; Short=FTR-B; Flags: Precursor gi|505189|emb|CAA54409.1| ferredoxin-thioredoxin reductase SU B [Spinacia oleracea] Length = 148 Score = 64.7 bits (156), Expect = 1e-08 Identities = 35/52 (67%), Positives = 40/52 (76%) Frame = +1 Query: 91 MKALQASTSYGFFVTPLSSGTLSEHLPRHQCVTLAQVDPSEKSVEIMRKFSE 246 MKALQASTSY FF + SS TL R QCV L++V+PS+KSVEIMRKFSE Sbjct: 1 MKALQASTSYSFF-SKSSSATLQRRTHRPQCVILSKVEPSDKSVEIMRKFSE 51