BLASTX nr result
ID: Achyranthes23_contig00013368
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00013368 (258 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006421267.1| hypothetical protein CICLE_v10006402mg [Citr... 56 4e-06 >ref|XP_006421267.1| hypothetical protein CICLE_v10006402mg [Citrus clementina] gi|557523140|gb|ESR34507.1| hypothetical protein CICLE_v10006402mg [Citrus clementina] Length = 60 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/39 (61%), Positives = 30/39 (76%) Frame = +2 Query: 134 DNIPPAGYPTLTPPEGKMKKKGWFRTKNRGEKGFLEGCL 250 +N PPAGYPT PP GK KKK +TK +G++GF+EGCL Sbjct: 9 NNQPPAGYPTENPPAGKGKKKCLSQTKKKGDRGFIEGCL 47