BLASTX nr result
ID: Achyranthes23_contig00013215
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00013215 (593 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517613.1| pentatricopeptide repeat-containing protein,... 58 2e-06 ref|XP_006465489.1| PREDICTED: pentatricopeptide repeat-containi... 56 6e-06 ref|XP_004152207.1| PREDICTED: pentatricopeptide repeat-containi... 56 6e-06 >ref|XP_002517613.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223543245|gb|EEF44777.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 400 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/41 (60%), Positives = 32/41 (78%) Frame = +2 Query: 212 YKNMHLFGCMRTIKSLNAILKVLAQTCDLEAII*FLMEAPK 334 + +MH++GC RT+KS NA LKVL +TCDLEAI FL E P+ Sbjct: 129 FNDMHMYGCKRTVKSFNAALKVLTETCDLEAIKAFLSEVPE 169 >ref|XP_006465489.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52620-like [Citrus sinensis] Length = 1259 Score = 56.2 bits (134), Expect = 6e-06 Identities = 32/63 (50%), Positives = 43/63 (68%), Gaps = 1/63 (1%) Frame = +2 Query: 149 LLTSKFQIIKH-LDTNNRRWYLYKNMHLFGCMRTIKSLNAILKVLAQTCDLEAII*FLME 325 +L K +IKH +DT + +MHL+GC RT+KSLNA LKVL ++ DL+AI FLME Sbjct: 123 MLYGKAGMIKHAMDT-------FYDMHLYGCKRTVKSLNAALKVLTESRDLKAIQAFLME 175 Query: 326 APK 334 P+ Sbjct: 176 VPE 178 >ref|XP_004152207.1| PREDICTED: pentatricopeptide repeat-containing protein At1g80150, mitochondrial-like [Cucumis sativus] gi|449484169|ref|XP_004156805.1| PREDICTED: pentatricopeptide repeat-containing protein At1g80150, mitochondrial-like [Cucumis sativus] Length = 399 Score = 56.2 bits (134), Expect = 6e-06 Identities = 31/63 (49%), Positives = 44/63 (69%), Gaps = 1/63 (1%) Frame = +2 Query: 149 LLTSKFQIIKH-LDTNNRRWYLYKNMHLFGCMRTIKSLNAILKVLAQTCDLEAII*FLME 325 +L K ++IKH LDT + +MHL+GC+RT+KS NA+LKVL ++ DL A+ FL E Sbjct: 113 MLYGKAEMIKHALDT-------FYDMHLYGCLRTVKSFNAVLKVLMKSRDLGALEAFLSE 165 Query: 326 APK 334 AP+ Sbjct: 166 APE 168