BLASTX nr result
ID: Achyranthes23_contig00012818
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00012818 (349 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004503120.1| PREDICTED: splicing factor 3B subunit 4-like... 62 8e-08 ref|XP_003540544.1| PREDICTED: splicing factor 3B subunit 4-like... 62 1e-07 ref|XP_002516394.1| spliceosome associated protein, putative [Ri... 62 1e-07 ref|XP_003534692.1| PREDICTED: splicing factor 3B subunit 4-like... 60 3e-07 ref|XP_003600696.1| Splicing factor 3B subunit [Medicago truncat... 60 3e-07 ref|XP_006425712.1| hypothetical protein CICLE_v10025862mg [Citr... 58 1e-06 ref|XP_006425711.1| hypothetical protein CICLE_v10025862mg [Citr... 58 1e-06 ref|XP_006425710.1| hypothetical protein CICLE_v10025862mg [Citr... 58 1e-06 gb|ESW05850.1| hypothetical protein PHAVU_011G214800g [Phaseolus... 58 1e-06 ref|XP_006341534.1| PREDICTED: splicing factor 3B subunit 4-like... 57 2e-06 ref|XP_006383228.1| hypothetical protein POPTR_0005s12680g, part... 57 2e-06 ref|XP_004235773.1| PREDICTED: splicing factor 3B subunit 4-like... 57 2e-06 ref|XP_006341070.1| PREDICTED: splicing factor 3B subunit 4-like... 57 3e-06 ref|XP_006856079.1| hypothetical protein AMTR_s00059p00117370 [A... 56 6e-06 gb|EPS66244.1| hypothetical protein M569_08532, partial [Genlise... 55 7e-06 ref|XP_002310211.2| hypothetical protein POPTR_0007s12570g [Popu... 55 9e-06 >ref|XP_004503120.1| PREDICTED: splicing factor 3B subunit 4-like [Cicer arietinum] Length = 379 Score = 62.0 bits (149), Expect = 8e-08 Identities = 31/45 (68%), Positives = 33/45 (73%), Gaps = 3/45 (6%) Frame = -1 Query: 349 SNPSTQKTRPHTLFASGPPTLP---QVNGTVPPPGTAVPRPLVNG 224 SNP+ QK+RPHTLFASGPPTLP Q NGTVP P PRP NG Sbjct: 210 SNPTAQKSRPHTLFASGPPTLPNVAQANGTVPAP--VPPRPFANG 252 >ref|XP_003540544.1| PREDICTED: splicing factor 3B subunit 4-like [Glycine max] Length = 364 Score = 61.6 bits (148), Expect = 1e-07 Identities = 31/45 (68%), Positives = 33/45 (73%), Gaps = 3/45 (6%) Frame = -1 Query: 349 SNPSTQKTRPHTLFASGPPTL---PQVNGTVPPPGTAVPRPLVNG 224 SNP+TQK+RPHTLFASGPPTL PQ NG P P PRP VNG Sbjct: 210 SNPTTQKSRPHTLFASGPPTLPSAPQANGVAPVP----PRPFVNG 250 >ref|XP_002516394.1| spliceosome associated protein, putative [Ricinus communis] gi|223544492|gb|EEF46011.1| spliceosome associated protein, putative [Ricinus communis] Length = 376 Score = 61.6 bits (148), Expect = 1e-07 Identities = 32/46 (69%), Positives = 34/46 (73%), Gaps = 3/46 (6%) Frame = -1 Query: 349 SNPSTQKTRPHTLFASGPPTL---PQVNGTVPPPGTAVPRPLVNGA 221 SNPS+QK+RPHTLFASGPPTL PQ NGTV P PRP NGA Sbjct: 210 SNPSSQKSRPHTLFASGPPTLPSIPQANGTVGAP--VPPRPFANGA 253 >ref|XP_003534692.1| PREDICTED: splicing factor 3B subunit 4-like [Glycine max] Length = 365 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/45 (66%), Positives = 32/45 (71%), Gaps = 3/45 (6%) Frame = -1 Query: 349 SNPSTQKTRPHTLFASGPPTL---PQVNGTVPPPGTAVPRPLVNG 224 SNP+TQK+RPHTLFASGPPTL PQ NG P P PRP NG Sbjct: 210 SNPTTQKSRPHTLFASGPPTLPSVPQANGVAPVP----PRPFANG 250 >ref|XP_003600696.1| Splicing factor 3B subunit [Medicago truncatula] gi|355489744|gb|AES70947.1| Splicing factor 3B subunit [Medicago truncatula] Length = 379 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/45 (64%), Positives = 33/45 (73%), Gaps = 3/45 (6%) Frame = -1 Query: 349 SNPSTQKTRPHTLFASGPPTL---PQVNGTVPPPGTAVPRPLVNG 224 SNP+ QK+RPHTLFASGPP+L PQ NGT+P P PRP NG Sbjct: 210 SNPTAQKSRPHTLFASGPPSLPNAPQANGTIPAP--VPPRPFANG 252 >ref|XP_006425712.1| hypothetical protein CICLE_v10025862mg [Citrus clementina] gi|568824776|ref|XP_006466770.1| PREDICTED: splicing factor 3B subunit 4-like [Citrus sinensis] gi|557527702|gb|ESR38952.1| hypothetical protein CICLE_v10025862mg [Citrus clementina] Length = 377 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/46 (65%), Positives = 34/46 (73%), Gaps = 3/46 (6%) Frame = -1 Query: 349 SNPSTQKTRPHTLFASGPPTL---PQVNGTVPPPGTAVPRPLVNGA 221 +NPS+QK+RPHTLFASGPP+L PQ NGTV G PRP NGA Sbjct: 210 NNPSSQKSRPHTLFASGPPSLQNAPQANGTV--GGPVPPRPYANGA 253 >ref|XP_006425711.1| hypothetical protein CICLE_v10025862mg [Citrus clementina] gi|557527701|gb|ESR38951.1| hypothetical protein CICLE_v10025862mg [Citrus clementina] Length = 290 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/46 (65%), Positives = 34/46 (73%), Gaps = 3/46 (6%) Frame = -1 Query: 349 SNPSTQKTRPHTLFASGPPTL---PQVNGTVPPPGTAVPRPLVNGA 221 +NPS+QK+RPHTLFASGPP+L PQ NGTV G PRP NGA Sbjct: 123 NNPSSQKSRPHTLFASGPPSLQNAPQANGTV--GGPVPPRPYANGA 166 >ref|XP_006425710.1| hypothetical protein CICLE_v10025862mg [Citrus clementina] gi|557527700|gb|ESR38950.1| hypothetical protein CICLE_v10025862mg [Citrus clementina] Length = 204 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/46 (65%), Positives = 34/46 (73%), Gaps = 3/46 (6%) Frame = -1 Query: 349 SNPSTQKTRPHTLFASGPPTL---PQVNGTVPPPGTAVPRPLVNGA 221 +NPS+QK+RPHTLFASGPP+L PQ NGTV G PRP NGA Sbjct: 37 NNPSSQKSRPHTLFASGPPSLQNAPQANGTV--GGPVPPRPYANGA 80 >gb|ESW05850.1| hypothetical protein PHAVU_011G214800g [Phaseolus vulgaris] Length = 365 Score = 57.8 bits (138), Expect = 1e-06 Identities = 29/45 (64%), Positives = 31/45 (68%), Gaps = 3/45 (6%) Frame = -1 Query: 349 SNPSTQKTRPHTLFASGPPTL---PQVNGTVPPPGTAVPRPLVNG 224 SNP+ QK+RPHTLFASGPPTL PQ NG P P PRP NG Sbjct: 210 SNPTAQKSRPHTLFASGPPTLPSVPQANGVAPLP----PRPFANG 250 >ref|XP_006341534.1| PREDICTED: splicing factor 3B subunit 4-like [Solanum tuberosum] Length = 364 Score = 57.0 bits (136), Expect = 2e-06 Identities = 29/45 (64%), Positives = 30/45 (66%), Gaps = 3/45 (6%) Frame = -1 Query: 349 SNPSTQKTRPHTLFASGPPTL---PQVNGTVPPPGTAVPRPLVNG 224 SNP TQK RPHT+FASGPPTL PQ NG V P PRP NG Sbjct: 210 SNPGTQKNRPHTMFASGPPTLPGVPQANGAVGAP--VPPRPFANG 252 >ref|XP_006383228.1| hypothetical protein POPTR_0005s12680g, partial [Populus trichocarpa] gi|550338810|gb|ERP61025.1| hypothetical protein POPTR_0005s12680g, partial [Populus trichocarpa] Length = 295 Score = 57.0 bits (136), Expect = 2e-06 Identities = 29/44 (65%), Positives = 31/44 (70%), Gaps = 1/44 (2%) Frame = -1 Query: 349 SNPSTQKTRPHTLFASGPPTLP-QVNGTVPPPGTAVPRPLVNGA 221 SNP+ QK+RPHTLFASGPPTLP NG V P PRP NGA Sbjct: 136 SNPTNQKSRPHTLFASGPPTLPTHANGAVMAP--VPPRPFANGA 177 >ref|XP_004235773.1| PREDICTED: splicing factor 3B subunit 4-like [Solanum lycopersicum] Length = 364 Score = 57.0 bits (136), Expect = 2e-06 Identities = 29/45 (64%), Positives = 30/45 (66%), Gaps = 3/45 (6%) Frame = -1 Query: 349 SNPSTQKTRPHTLFASGPPTL---PQVNGTVPPPGTAVPRPLVNG 224 SNP TQK RPHT+FASGPPTL PQ NG V P PRP NG Sbjct: 210 SNPGTQKNRPHTMFASGPPTLPGVPQANGAVGAP--VPPRPFANG 252 >ref|XP_006341070.1| PREDICTED: splicing factor 3B subunit 4-like [Solanum tuberosum] Length = 363 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/45 (64%), Positives = 30/45 (66%), Gaps = 3/45 (6%) Frame = -1 Query: 349 SNPSTQKTRPHTLFASGPPTL---PQVNGTVPPPGTAVPRPLVNG 224 SNP TQK RPHT+FASGPPTL PQ NG V P PRP NG Sbjct: 210 SNPGTQKNRPHTMFASGPPTLPGVPQANGAVGAP--IPPRPFANG 252 >ref|XP_006856079.1| hypothetical protein AMTR_s00059p00117370 [Amborella trichopoda] gi|548859938|gb|ERN17546.1| hypothetical protein AMTR_s00059p00117370 [Amborella trichopoda] Length = 385 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/50 (56%), Positives = 31/50 (62%), Gaps = 8/50 (16%) Frame = -1 Query: 349 SNPSTQKTRPHTLFASGPPTL-PQVNGTVPPPGTAV-------PRPLVNG 224 SNP+ Q+ RPHTLFASGPPT PQ NG +P P A PRP NG Sbjct: 210 SNPAAQRNRPHTLFASGPPTAPPQANGAIPNPPMAAQSQPPPPPRPFANG 259 >gb|EPS66244.1| hypothetical protein M569_08532, partial [Genlisea aurea] Length = 90 Score = 55.5 bits (132), Expect = 7e-06 Identities = 28/44 (63%), Positives = 32/44 (72%), Gaps = 1/44 (2%) Frame = -1 Query: 349 SNPSTQKTRPHTLFASGPPTL-PQVNGTVPPPGTAVPRPLVNGA 221 SNPST + RPHT+FASGPP+L PQ NG VPP PRP NG+ Sbjct: 38 SNPSTLRHRPHTMFASGPPSLAPQPNGAVPP---VPPRPFPNGS 78 >ref|XP_002310211.2| hypothetical protein POPTR_0007s12570g [Populus trichocarpa] gi|550334734|gb|EEE90661.2| hypothetical protein POPTR_0007s12570g [Populus trichocarpa] Length = 377 Score = 55.1 bits (131), Expect = 9e-06 Identities = 28/43 (65%), Positives = 31/43 (72%), Gaps = 1/43 (2%) Frame = -1 Query: 349 SNPSTQKTRPHTLFASGPPTL-PQVNGTVPPPGTAVPRPLVNG 224 SNP+TQK+RPHTLFASGPPTL Q NG + P PRP NG Sbjct: 210 SNPTTQKSRPHTLFASGPPTLASQANGAMVAP--VPPRPFANG 250