BLASTX nr result
ID: Achyranthes23_contig00012224
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00012224 (445 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS70787.1| hypothetical protein M569_03972, partial [Genlise... 78 1e-12 ref|XP_002887646.1| chlorophyll A-B binding family protein [Arab... 77 2e-12 ref|XP_006390178.1| hypothetical protein EUTSA_v10018862mg [Eutr... 77 3e-12 ref|XP_006390176.1| hypothetical protein EUTSA_v10018862mg [Eutr... 77 3e-12 ref|NP_177783.1| chlorophyll A-B binding family protein [Arabido... 75 7e-12 gb|EMJ10548.1| hypothetical protein PRUPE_ppa008546mg [Prunus pe... 75 9e-12 ref|XP_002307004.1| chlorophyll A-B binding family protein [Popu... 75 9e-12 ref|XP_006421927.1| hypothetical protein CICLE_v10006886mg, part... 75 1e-11 ref|XP_002276647.1| PREDICTED: chlorophyll a-b binding protein o... 74 3e-11 gb|ESW32583.1| hypothetical protein PHAVU_001G000400g [Phaseolus... 73 3e-11 ref|XP_004301607.1| PREDICTED: chlorophyll a-b binding protein o... 73 3e-11 ref|XP_002510744.1| chlorophyll A/B binding protein, putative [R... 73 3e-11 ref|NP_001240088.1| uncharacterized protein LOC100786260 [Glycin... 73 4e-11 gb|EXB56249.1| Chlorophyll a-b binding protein of LHCII type III... 72 6e-11 ref|XP_006490397.1| PREDICTED: chlorophyll a-b binding protein 1... 72 6e-11 ref|XP_006490396.1| PREDICTED: chlorophyll a-b binding protein 1... 72 6e-11 ref|XP_006490395.1| PREDICTED: chlorophyll a-b binding protein 1... 72 6e-11 ref|XP_006302513.1| hypothetical protein CARUB_v10020611mg, part... 72 8e-11 ref|XP_004169873.1| PREDICTED: chlorophyll a-b binding protein o... 72 8e-11 ref|XP_004145567.1| PREDICTED: chlorophyll a-b binding protein o... 72 8e-11 >gb|EPS70787.1| hypothetical protein M569_03972, partial [Genlisea aurea] Length = 314 Score = 77.8 bits (190), Expect = 1e-12 Identities = 37/44 (84%), Positives = 40/44 (90%), Gaps = 1/44 (2%) Frame = +2 Query: 2 FEILHARWAMLGALGALIPEI-DLTGAFHFAEPV*WKVAYSKLK 130 FE+LHARWAML ALGAL+PEI DLTGAFHFAEPV W+V YSKLK Sbjct: 145 FEVLHARWAMLAALGALLPEILDLTGAFHFAEPVWWRVGYSKLK 188 >ref|XP_002887646.1| chlorophyll A-B binding family protein [Arabidopsis lyrata subsp. lyrata] gi|297333487|gb|EFH63905.1| chlorophyll A-B binding family protein [Arabidopsis lyrata subsp. lyrata] Length = 330 Score = 77.0 bits (188), Expect = 2e-12 Identities = 37/44 (84%), Positives = 40/44 (90%), Gaps = 1/44 (2%) Frame = +2 Query: 2 FEILHARWAMLGALGALIPEI-DLTGAFHFAEPV*WKVAYSKLK 130 FEILHARWAML ALGALIPE+ DLTGAFHFAEPV W+V YSKL+ Sbjct: 157 FEILHARWAMLAALGALIPEVLDLTGAFHFAEPVWWRVGYSKLQ 200 >ref|XP_006390178.1| hypothetical protein EUTSA_v10018862mg [Eutrema salsugineum] gi|557086612|gb|ESQ27464.1| hypothetical protein EUTSA_v10018862mg [Eutrema salsugineum] Length = 326 Score = 76.6 bits (187), Expect = 3e-12 Identities = 36/44 (81%), Positives = 40/44 (90%), Gaps = 1/44 (2%) Frame = +2 Query: 2 FEILHARWAMLGALGALIPEI-DLTGAFHFAEPV*WKVAYSKLK 130 FEILHARWAML ALGAL+PE+ DLTGAFHFAEPV W+V YSKL+ Sbjct: 153 FEILHARWAMLAALGALVPEVFDLTGAFHFAEPVWWRVGYSKLQ 196 >ref|XP_006390176.1| hypothetical protein EUTSA_v10018862mg [Eutrema salsugineum] gi|567120619|ref|XP_006390177.1| hypothetical protein EUTSA_v10018862mg [Eutrema salsugineum] gi|557086610|gb|ESQ27462.1| hypothetical protein EUTSA_v10018862mg [Eutrema salsugineum] gi|557086611|gb|ESQ27463.1| hypothetical protein EUTSA_v10018862mg [Eutrema salsugineum] Length = 241 Score = 76.6 bits (187), Expect = 3e-12 Identities = 36/44 (81%), Positives = 40/44 (90%), Gaps = 1/44 (2%) Frame = +2 Query: 2 FEILHARWAMLGALGALIPEI-DLTGAFHFAEPV*WKVAYSKLK 130 FEILHARWAML ALGAL+PE+ DLTGAFHFAEPV W+V YSKL+ Sbjct: 68 FEILHARWAMLAALGALVPEVFDLTGAFHFAEPVWWRVGYSKLQ 111 >ref|NP_177783.1| chlorophyll A-B binding family protein [Arabidopsis thaliana] gi|12323973|gb|AAG51944.1|AC015450_5 putative chlorophyll A-B binding protein; 65434-67056 [Arabidopsis thaliana] gi|332197739|gb|AEE35860.1| chlorophyll A-B binding family protein [Arabidopsis thaliana] Length = 327 Score = 75.5 bits (184), Expect = 7e-12 Identities = 36/44 (81%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = +2 Query: 2 FEILHARWAMLGALGALIPEI-DLTGAFHFAEPV*WKVAYSKLK 130 FEILHARWAML ALGALIPE+ DLTG FHFAEPV W+V YSKL+ Sbjct: 154 FEILHARWAMLAALGALIPEVFDLTGTFHFAEPVWWRVGYSKLQ 197 >gb|EMJ10548.1| hypothetical protein PRUPE_ppa008546mg [Prunus persica] Length = 327 Score = 75.1 bits (183), Expect = 9e-12 Identities = 37/44 (84%), Positives = 38/44 (86%), Gaps = 1/44 (2%) Frame = +2 Query: 2 FEILHARWAMLGALGALIPEI-DLTGAFHFAEPV*WKVAYSKLK 130 FEILHARWAML ALGALIPEI DL GAFHF EPV W+V YSKLK Sbjct: 153 FEILHARWAMLAALGALIPEILDLLGAFHFVEPVWWRVGYSKLK 196 >ref|XP_002307004.1| chlorophyll A-B binding family protein [Populus trichocarpa] gi|222856453|gb|EEE94000.1| chlorophyll A-B binding family protein [Populus trichocarpa] Length = 338 Score = 75.1 bits (183), Expect = 9e-12 Identities = 36/44 (81%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = +2 Query: 2 FEILHARWAMLGALGALIPEI-DLTGAFHFAEPV*WKVAYSKLK 130 FEILHARWAML ALGALIPE+ DL+GAFHF EPV W+V YSKLK Sbjct: 164 FEILHARWAMLAALGALIPEVLDLSGAFHFIEPVWWRVGYSKLK 207 >ref|XP_006421927.1| hypothetical protein CICLE_v10006886mg, partial [Citrus clementina] gi|557523800|gb|ESR35167.1| hypothetical protein CICLE_v10006886mg, partial [Citrus clementina] Length = 300 Score = 74.7 bits (182), Expect = 1e-11 Identities = 34/44 (77%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = +2 Query: 2 FEILHARWAMLGALGALIPEI-DLTGAFHFAEPV*WKVAYSKLK 130 FEILHARWAMLGALGAL+PE+ D+ GAFHF EPV W+V YSKL+ Sbjct: 164 FEILHARWAMLGALGALVPEVLDMVGAFHFVEPVWWRVGYSKLQ 207 >ref|XP_002276647.1| PREDICTED: chlorophyll a-b binding protein of LHCII type I, chloroplastic [Vitis vinifera] gi|297745621|emb|CBI40786.3| unnamed protein product [Vitis vinifera] Length = 331 Score = 73.6 bits (179), Expect = 3e-11 Identities = 35/44 (79%), Positives = 38/44 (86%), Gaps = 1/44 (2%) Frame = +2 Query: 2 FEILHARWAMLGALGALIPE-IDLTGAFHFAEPV*WKVAYSKLK 130 FEILHARWAML ALGAL+PE +DL GAFHF EPV W+V YSKLK Sbjct: 157 FEILHARWAMLAALGALLPELLDLLGAFHFVEPVWWRVGYSKLK 200 >gb|ESW32583.1| hypothetical protein PHAVU_001G000400g [Phaseolus vulgaris] Length = 329 Score = 73.2 bits (178), Expect = 3e-11 Identities = 35/44 (79%), Positives = 38/44 (86%), Gaps = 1/44 (2%) Frame = +2 Query: 2 FEILHARWAMLGALGALIPEI-DLTGAFHFAEPV*WKVAYSKLK 130 FEILHARWAML ++GALIPEI DL GAFHF EPV W+V YSKLK Sbjct: 151 FEILHARWAMLASIGALIPEILDLLGAFHFVEPVWWRVGYSKLK 194 >ref|XP_004301607.1| PREDICTED: chlorophyll a-b binding protein of LHCII type I, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 308 Score = 73.2 bits (178), Expect = 3e-11 Identities = 35/44 (79%), Positives = 37/44 (84%), Gaps = 1/44 (2%) Frame = +2 Query: 2 FEILHARWAMLGALGALIPEI-DLTGAFHFAEPV*WKVAYSKLK 130 FEILHARWAML A GAL+PEI DL GAFHF EPV W+V YSKLK Sbjct: 153 FEILHARWAMLAAFGALVPEILDLLGAFHFVEPVWWRVGYSKLK 196 >ref|XP_002510744.1| chlorophyll A/B binding protein, putative [Ricinus communis] gi|223551445|gb|EEF52931.1| chlorophyll A/B binding protein, putative [Ricinus communis] Length = 329 Score = 73.2 bits (178), Expect = 3e-11 Identities = 35/44 (79%), Positives = 38/44 (86%), Gaps = 1/44 (2%) Frame = +2 Query: 2 FEILHARWAMLGALGALIPEI-DLTGAFHFAEPV*WKVAYSKLK 130 FEILHARWAML ALGAL PE+ DL+GAFHF EPV W+V YSKLK Sbjct: 155 FEILHARWAMLAALGALAPEVLDLSGAFHFIEPVWWRVGYSKLK 198 >ref|NP_001240088.1| uncharacterized protein LOC100786260 [Glycine max] gi|255636882|gb|ACU18774.1| unknown [Glycine max] Length = 331 Score = 72.8 bits (177), Expect = 4e-11 Identities = 35/44 (79%), Positives = 38/44 (86%), Gaps = 1/44 (2%) Frame = +2 Query: 2 FEILHARWAMLGALGALIPEI-DLTGAFHFAEPV*WKVAYSKLK 130 FEILHARWAML ++GALIPEI DL GAFHF EPV W+V YSKLK Sbjct: 153 FEILHARWAMLASVGALIPEILDLLGAFHFVEPVWWRVGYSKLK 196 >gb|EXB56249.1| Chlorophyll a-b binding protein of LHCII type III [Morus notabilis] Length = 289 Score = 72.4 bits (176), Expect = 6e-11 Identities = 35/44 (79%), Positives = 37/44 (84%), Gaps = 1/44 (2%) Frame = +2 Query: 2 FEILHARWAMLGALGALIPEI-DLTGAFHFAEPV*WKVAYSKLK 130 FEILHARWAML ALG +IPEI DL GAFHF EPV W+V YSKLK Sbjct: 116 FEILHARWAMLAALGVVIPEILDLLGAFHFVEPVWWRVGYSKLK 159 >ref|XP_006490397.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like isoform X3 [Citrus sinensis] Length = 300 Score = 72.4 bits (176), Expect = 6e-11 Identities = 33/44 (75%), Positives = 38/44 (86%), Gaps = 1/44 (2%) Frame = +2 Query: 2 FEILHARWAMLGALGALIPEI-DLTGAFHFAEPV*WKVAYSKLK 130 FEILHARWAMLGALGAL+PE+ D+ GAFH EPV W+V YSKL+ Sbjct: 76 FEILHARWAMLGALGALVPEVLDMVGAFHLVEPVWWRVGYSKLQ 119 >ref|XP_006490396.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like isoform X2 [Citrus sinensis] Length = 338 Score = 72.4 bits (176), Expect = 6e-11 Identities = 33/44 (75%), Positives = 38/44 (86%), Gaps = 1/44 (2%) Frame = +2 Query: 2 FEILHARWAMLGALGALIPEI-DLTGAFHFAEPV*WKVAYSKLK 130 FEILHARWAMLGALGAL+PE+ D+ GAFH EPV W+V YSKL+ Sbjct: 164 FEILHARWAMLGALGALVPEVLDMVGAFHLVEPVWWRVGYSKLQ 207 >ref|XP_006490395.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like isoform X1 [Citrus sinensis] Length = 388 Score = 72.4 bits (176), Expect = 6e-11 Identities = 33/44 (75%), Positives = 38/44 (86%), Gaps = 1/44 (2%) Frame = +2 Query: 2 FEILHARWAMLGALGALIPEI-DLTGAFHFAEPV*WKVAYSKLK 130 FEILHARWAMLGALGAL+PE+ D+ GAFH EPV W+V YSKL+ Sbjct: 164 FEILHARWAMLGALGALVPEVLDMVGAFHLVEPVWWRVGYSKLQ 207 >ref|XP_006302513.1| hypothetical protein CARUB_v10020611mg, partial [Capsella rubella] gi|482571223|gb|EOA35411.1| hypothetical protein CARUB_v10020611mg, partial [Capsella rubella] Length = 337 Score = 72.0 bits (175), Expect = 8e-11 Identities = 35/44 (79%), Positives = 38/44 (86%), Gaps = 1/44 (2%) Frame = +2 Query: 2 FEILHARWAMLGALGALIPEI-DLTGAFHFAEPV*WKVAYSKLK 130 FEILHARWAML ALG +IPEI DLTGAFHFAE V W+V YSKL+ Sbjct: 164 FEILHARWAMLAALGVIIPEIFDLTGAFHFAESVWWRVGYSKLQ 207 >ref|XP_004169873.1| PREDICTED: chlorophyll a-b binding protein of LHCII type I, chloroplastic-like [Cucumis sativus] Length = 338 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/44 (75%), Positives = 38/44 (86%), Gaps = 1/44 (2%) Frame = +2 Query: 2 FEILHARWAMLGALGALIPEI-DLTGAFHFAEPV*WKVAYSKLK 130 FEILHARWAML +LGAL+PEI D+ GAFHF EP+ W+V YSKLK Sbjct: 161 FEILHARWAMLASLGALVPEILDIFGAFHFTEPIWWRVGYSKLK 204 >ref|XP_004145567.1| PREDICTED: chlorophyll a-b binding protein of LHCII type I, chloroplastic-like [Cucumis sativus] Length = 338 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/44 (75%), Positives = 38/44 (86%), Gaps = 1/44 (2%) Frame = +2 Query: 2 FEILHARWAMLGALGALIPEI-DLTGAFHFAEPV*WKVAYSKLK 130 FEILHARWAML +LGAL+PEI D+ GAFHF EP+ W+V YSKLK Sbjct: 161 FEILHARWAMLASLGALVPEILDIFGAFHFTEPIWWRVGYSKLK 204