BLASTX nr result
ID: Achyranthes23_contig00011796
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00011796 (217 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB93374.1| hypothetical protein L484_010701 [Morus notabilis] 60 4e-07 >gb|EXB93374.1| hypothetical protein L484_010701 [Morus notabilis] Length = 213 Score = 59.7 bits (143), Expect = 4e-07 Identities = 30/54 (55%), Positives = 36/54 (66%) Frame = -1 Query: 172 VKMGTPIKXXXXXXXXXXSNKQKLASKNGDIKAKKRVVEDSDDEIIGIPKRRKA 11 ++MGTPIK S KQ ASKNGD+K K+R+V DSDD+ I PKRRKA Sbjct: 160 IRMGTPIKPLKPPSKPESSQKQLQASKNGDVKVKRRIVNDSDDDFILSPKRRKA 213