BLASTX nr result
ID: Achyranthes23_contig00011669
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00011669 (829 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006425755.1| hypothetical protein CICLE_v10027311mg [Citr... 62 3e-07 >ref|XP_006425755.1| hypothetical protein CICLE_v10027311mg [Citrus clementina] gi|568824728|ref|XP_006466748.1| PREDICTED: lysM domain receptor-like kinase 4-like [Citrus sinensis] gi|557527745|gb|ESR38995.1| hypothetical protein CICLE_v10027311mg [Citrus clementina] Length = 632 Score = 61.6 bits (148), Expect = 3e-07 Identities = 42/116 (36%), Positives = 62/116 (53%), Gaps = 7/116 (6%) Frame = +2 Query: 158 STRLAPPQNSPVNPPIVLEYPSAITSFSENSSRRWLYFGLGVLVGGTFASVFMFILFCLF 337 S + PP ++PV PP P A +S + S++ W+Y GVL G T +F I+FC F Sbjct: 241 SQTVEPPSSTPVTPPS----PPANSSSEDGSNKTWIYIVAGVLGGITLTLIFGAIIFCKF 296 Query: 338 ---RRRFPAFVSSSQRFQNHENMDFAKKYPEINVDDVAKIA----SLKIYNFKNLQ 484 +++ P V S FQ +E KK+ E + D + I+ SLK+Y+FK LQ Sbjct: 297 FYTKKKEPDSVVVSGSFQANEK-PMNKKFDEESQDFLESISGVAQSLKVYSFKELQ 351