BLASTX nr result
ID: Achyranthes23_contig00011173
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00011173 (238 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003631424.1| PREDICTED: BON1-associated protein 2-like [V... 62 1e-07 emb|CAN82266.1| hypothetical protein VITISV_009284 [Vitis vinifera] 62 1e-07 ref|XP_002509742.1| conserved hypothetical protein [Ricinus comm... 55 1e-05 >ref|XP_003631424.1| PREDICTED: BON1-associated protein 2-like [Vitis vinifera] Length = 230 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/50 (52%), Positives = 34/50 (68%) Frame = -3 Query: 236 YSCVYLQIFTKRALLGPSPLGWIQIPGSDIFDGKYPVGLVHHLSYRVREK 87 YS +YL I+TKR + G LGW QIP DI +G P G + HLSYR+R++ Sbjct: 89 YSAIYLHIYTKRLMKGKIQLGWCQIPAGDILEGFSPAGTLRHLSYRLRDR 138 >emb|CAN82266.1| hypothetical protein VITISV_009284 [Vitis vinifera] Length = 246 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/50 (52%), Positives = 34/50 (68%) Frame = -3 Query: 236 YSCVYLQIFTKRALLGPSPLGWIQIPGSDIFDGKYPVGLVHHLSYRVREK 87 YS +YL I+TKR + G LGW QIP DI +G P G + HLSYR+R++ Sbjct: 89 YSAIYLHIYTKRLMKGKIQLGWCQIPAGDILEGFSPAGTLRHLSYRLRDR 138 >ref|XP_002509742.1| conserved hypothetical protein [Ricinus communis] gi|223549641|gb|EEF51129.1| conserved hypothetical protein [Ricinus communis] Length = 223 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/50 (52%), Positives = 35/50 (70%) Frame = -3 Query: 236 YSCVYLQIFTKRALLGPSPLGWIQIPGSDIFDGKYPVGLVHHLSYRVREK 87 YSC+Y++++TKR L G LGW QIP +DI G P V HLSYR+R++ Sbjct: 79 YSCIYVELYTKRLLKGKVLLGWCQIPVTDI--GFPPDSSVRHLSYRIRDR 126