BLASTX nr result
ID: Achyranthes23_contig00010775
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00010775 (286 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002509433.1| conserved hypothetical protein [Ricinus comm... 57 3e-06 >ref|XP_002509433.1| conserved hypothetical protein [Ricinus communis] gi|223549332|gb|EEF50820.1| conserved hypothetical protein [Ricinus communis] Length = 217 Score = 56.6 bits (135), Expect = 3e-06 Identities = 36/101 (35%), Positives = 51/101 (50%), Gaps = 24/101 (23%) Frame = -2 Query: 261 DEQQEQPAFIPQTTQTGYGLYGHDNEYHQNNYAPELK-----GLSSESETKY-------- 121 ++Q+E+P F+P+T Q GYGLYG ++ Q +L+ G +S E+ Y Sbjct: 55 NKQEEEPTFMPET-QNGYGLYGQESTQTQFPTTTKLEQQQNLGETSLQESSYTTMTNPNN 113 Query: 120 -----NGGV------EKQGISDTSVLDNAKYYYHVNAEKNY 31 N G E+QG+SDT L+N KYYY E NY Sbjct: 114 YNNYNNNGANGYSNSERQGMSDTRYLENGKYYYDARGENNY 154