BLASTX nr result
ID: Achyranthes23_contig00010665
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00010665 (298 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003530822.2| PREDICTED: enhancer of mRNA-decapping protei... 57 2e-06 ref|XP_006603142.1| PREDICTED: enhancer of mRNA-decapping protei... 57 3e-06 gb|ESW18676.1| hypothetical protein PHAVU_006G060500g [Phaseolus... 56 6e-06 gb|EXB51055.1| Enhancer of mRNA-decapping protein 4 [Morus notab... 55 7e-06 >ref|XP_003530822.2| PREDICTED: enhancer of mRNA-decapping protein 4-like [Glycine max] Length = 1345 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/35 (71%), Positives = 32/35 (91%) Frame = +3 Query: 3 QILNHQRSLPTSSGPELASIRVVMHVINSMLLNCK 107 QILNHQRSLPT +G +L+SIR+++HVINSML+ CK Sbjct: 1311 QILNHQRSLPTMTGADLSSIRLLLHVINSMLMTCK 1345 >ref|XP_006603142.1| PREDICTED: enhancer of mRNA-decapping protein 4-like, partial [Glycine max] Length = 1135 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/35 (68%), Positives = 32/35 (91%) Frame = +3 Query: 3 QILNHQRSLPTSSGPELASIRVVMHVINSMLLNCK 107 QILNHQRSLPT +G +L+SIR+++HV+NSML+ CK Sbjct: 1101 QILNHQRSLPTMTGVDLSSIRLLLHVVNSMLMTCK 1135 >gb|ESW18676.1| hypothetical protein PHAVU_006G060500g [Phaseolus vulgaris] Length = 1329 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/35 (65%), Positives = 32/35 (91%) Frame = +3 Query: 3 QILNHQRSLPTSSGPELASIRVVMHVINSMLLNCK 107 QILNHQR+LPT +G +L+SIR+++HV+NSML+ CK Sbjct: 1295 QILNHQRNLPTMTGTDLSSIRLLLHVVNSMLMTCK 1329 >gb|EXB51055.1| Enhancer of mRNA-decapping protein 4 [Morus notabilis] Length = 1582 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = +3 Query: 3 QILNHQRSLPTSSGPELASIRVVMHVINSMLLNCK 107 QIL+HQRSLPT +GPEL SIR++M VINSML+ CK Sbjct: 1548 QILHHQRSLPTMTGPELTSIRLLMLVINSMLMACK 1582