BLASTX nr result
ID: Achyranthes23_contig00009999
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00009999 (406 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006358427.1| PREDICTED: U6 snRNA-associated Sm-like prote... 112 5e-23 ref|XP_004247493.1| PREDICTED: BTB/POZ and MATH domain-containin... 112 5e-23 ref|XP_004242327.1| PREDICTED: U6 snRNA-associated Sm-like prote... 112 5e-23 ref|XP_006352785.1| PREDICTED: U6 snRNA-associated Sm-like prote... 110 3e-22 gb|EOX94843.1| BTB-POZ and MATH domain 2 [Theobroma cacao] 108 7e-22 ref|XP_006444137.1| hypothetical protein CICLE_v10023059mg [Citr... 107 1e-21 gb|EXB42565.1| hypothetical protein L484_011338 [Morus notabilis] 107 2e-21 ref|XP_004493646.1| PREDICTED: U6 snRNA-associated Sm-like prote... 107 2e-21 ref|XP_004493645.1| PREDICTED: BTB/POZ and MATH domain-containin... 107 2e-21 ref|XP_004294156.1| PREDICTED: U6 snRNA-associated Sm-like prote... 107 2e-21 ref|XP_004135926.1| PREDICTED: U6 snRNA-associated Sm-like prote... 107 2e-21 gb|ESW34388.1| hypothetical protein PHAVU_001G148500g [Phaseolus... 107 2e-21 gb|EPS69310.1| hypothetical protein M569_05456 [Genlisea aurea] 107 2e-21 ref|XP_002271534.2| PREDICTED: BTB/POZ and MATH domain-containin... 107 2e-21 emb|CBI32330.3| unnamed protein product [Vitis vinifera] 107 2e-21 ref|XP_003625831.1| SnRNP core Sm protein Sm-X5-like protein [Me... 107 2e-21 ref|XP_002304049.1| small nuclear ribonucleoprotein D [Populus t... 106 4e-21 gb|ABK93861.1| unknown [Populus trichocarpa] 106 4e-21 ref|XP_006305805.1| hypothetical protein CARUB_v10010754mg [Caps... 105 5e-21 gb|EMJ13495.1| hypothetical protein PRUPE_ppa013967mg [Prunus pe... 105 5e-21 >ref|XP_006358427.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm2-like [Solanum tuberosum] Length = 93 Score = 112 bits (280), Expect = 5e-23 Identities = 52/53 (98%), Positives = 53/53 (100%) Frame = -2 Query: 405 ENTRVVDEDKYPHMRSVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG 247 ENTRVVDEDKYPHMRSVRNCFIRGSVVRYVQLPPDGVD+ELLHDATRREARGG Sbjct: 41 ENTRVVDEDKYPHMRSVRNCFIRGSVVRYVQLPPDGVDIELLHDATRREARGG 93 >ref|XP_004247493.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like [Solanum lycopersicum] Length = 499 Score = 112 bits (280), Expect = 5e-23 Identities = 52/53 (98%), Positives = 53/53 (100%) Frame = -2 Query: 405 ENTRVVDEDKYPHMRSVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG 247 ENTRVVDEDKYPHMRSVRNCFIRGSVVRYVQLPPDGVD+ELLHDATRREARGG Sbjct: 447 ENTRVVDEDKYPHMRSVRNCFIRGSVVRYVQLPPDGVDIELLHDATRREARGG 499 >ref|XP_004242327.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm2-like [Solanum lycopersicum] Length = 93 Score = 112 bits (280), Expect = 5e-23 Identities = 52/53 (98%), Positives = 53/53 (100%) Frame = -2 Query: 405 ENTRVVDEDKYPHMRSVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG 247 ENTRVVDEDKYPHMRSVRNCFIRGSVVRYVQLPPDGVD+ELLHDATRREARGG Sbjct: 41 ENTRVVDEDKYPHMRSVRNCFIRGSVVRYVQLPPDGVDIELLHDATRREARGG 93 >ref|XP_006352785.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm2-like [Solanum tuberosum] Length = 93 Score = 110 bits (274), Expect = 3e-22 Identities = 51/53 (96%), Positives = 52/53 (98%) Frame = -2 Query: 405 ENTRVVDEDKYPHMRSVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG 247 ENT VVDEDKYPHMRSVRNCFIRGSVVRYVQLPPDGVD+ELLHDATRREARGG Sbjct: 41 ENTSVVDEDKYPHMRSVRNCFIRGSVVRYVQLPPDGVDIELLHDATRREARGG 93 >gb|EOX94843.1| BTB-POZ and MATH domain 2 [Theobroma cacao] Length = 493 Score = 108 bits (270), Expect = 7e-22 Identities = 50/53 (94%), Positives = 52/53 (98%) Frame = -2 Query: 405 ENTRVVDEDKYPHMRSVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG 247 ENTRVVD+DKYPHM SVRNCFIRGSVVRYVQLPPDGVD+ELLHDATRREARGG Sbjct: 441 ENTRVVDQDKYPHMLSVRNCFIRGSVVRYVQLPPDGVDIELLHDATRREARGG 493 >ref|XP_006444137.1| hypothetical protein CICLE_v10023059mg [Citrus clementina] gi|568852209|ref|XP_006479772.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm2-like [Citrus sinensis] gi|557546399|gb|ESR57377.1| hypothetical protein CICLE_v10023059mg [Citrus clementina] Length = 93 Score = 107 bits (268), Expect = 1e-21 Identities = 50/53 (94%), Positives = 52/53 (98%) Frame = -2 Query: 405 ENTRVVDEDKYPHMRSVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG 247 ENTRVVD+DKYPHM SVRNCFIRGSVVRYVQLPPDGVDV+LLHDATRREARGG Sbjct: 41 ENTRVVDQDKYPHMLSVRNCFIRGSVVRYVQLPPDGVDVDLLHDATRREARGG 93 >gb|EXB42565.1| hypothetical protein L484_011338 [Morus notabilis] Length = 140 Score = 107 bits (267), Expect = 2e-21 Identities = 50/53 (94%), Positives = 52/53 (98%) Frame = -2 Query: 405 ENTRVVDEDKYPHMRSVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG 247 ENTRVVD+DKYPHM SVRNCFIRGSVVRYVQLPP+GVDVELLHDATRREARGG Sbjct: 88 ENTRVVDQDKYPHMLSVRNCFIRGSVVRYVQLPPEGVDVELLHDATRREARGG 140 >ref|XP_004493646.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm2-like [Cicer arietinum] Length = 93 Score = 107 bits (267), Expect = 2e-21 Identities = 50/53 (94%), Positives = 52/53 (98%) Frame = -2 Query: 405 ENTRVVDEDKYPHMRSVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG 247 ENTRVVD+DKYPHM SVRNCFIRGSVVRYVQLPP+GVDVELLHDATRREARGG Sbjct: 41 ENTRVVDQDKYPHMLSVRNCFIRGSVVRYVQLPPEGVDVELLHDATRREARGG 93 >ref|XP_004493645.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like [Cicer arietinum] Length = 497 Score = 107 bits (267), Expect = 2e-21 Identities = 50/53 (94%), Positives = 52/53 (98%) Frame = -2 Query: 405 ENTRVVDEDKYPHMRSVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG 247 ENTRVVD+DKYPHM SVRNCFIRGSVVRYVQLPP+GVDVELLHDATRREARGG Sbjct: 445 ENTRVVDQDKYPHMLSVRNCFIRGSVVRYVQLPPEGVDVELLHDATRREARGG 497 >ref|XP_004294156.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm2-like [Fragaria vesca subsp. vesca] Length = 93 Score = 107 bits (267), Expect = 2e-21 Identities = 50/53 (94%), Positives = 52/53 (98%) Frame = -2 Query: 405 ENTRVVDEDKYPHMRSVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG 247 ENTRVVD+DKYPHM SVRNCFIRGSVVRYVQLPP+GVDVELLHDATRREARGG Sbjct: 41 ENTRVVDQDKYPHMLSVRNCFIRGSVVRYVQLPPEGVDVELLHDATRREARGG 93 >ref|XP_004135926.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm2-like isoform 1 [Cucumis sativus] gi|449436293|ref|XP_004135927.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm2-like isoform 2 [Cucumis sativus] gi|449436295|ref|XP_004135928.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm2-like isoform 3 [Cucumis sativus] gi|449489026|ref|XP_004158193.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm2-like isoform 1 [Cucumis sativus] gi|449489028|ref|XP_004158194.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm2-like isoform 2 [Cucumis sativus] gi|449489032|ref|XP_004158195.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm2-like isoform 3 [Cucumis sativus] Length = 93 Score = 107 bits (267), Expect = 2e-21 Identities = 50/53 (94%), Positives = 52/53 (98%) Frame = -2 Query: 405 ENTRVVDEDKYPHMRSVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG 247 ENTRVVD++KYPHM SVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG Sbjct: 41 ENTRVVDQEKYPHMLSVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG 93 >gb|ESW34388.1| hypothetical protein PHAVU_001G148500g [Phaseolus vulgaris] Length = 125 Score = 107 bits (266), Expect = 2e-21 Identities = 49/53 (92%), Positives = 52/53 (98%) Frame = -2 Query: 405 ENTRVVDEDKYPHMRSVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG 247 ENTRVVD+DKYPHM SVRNCFIRGSVVRYVQLPP+GVD+ELLHDATRREARGG Sbjct: 73 ENTRVVDQDKYPHMLSVRNCFIRGSVVRYVQLPPEGVDIELLHDATRREARGG 125 >gb|EPS69310.1| hypothetical protein M569_05456 [Genlisea aurea] Length = 93 Score = 107 bits (266), Expect = 2e-21 Identities = 49/53 (92%), Positives = 52/53 (98%) Frame = -2 Query: 405 ENTRVVDEDKYPHMRSVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG 247 ENTRV+D++KYPHM SVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG Sbjct: 41 ENTRVIDQEKYPHMLSVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG 93 >ref|XP_002271534.2| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like [Vitis vinifera] Length = 489 Score = 107 bits (266), Expect = 2e-21 Identities = 49/53 (92%), Positives = 52/53 (98%) Frame = -2 Query: 405 ENTRVVDEDKYPHMRSVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG 247 ENTRVVD+DKYPHM SVRNCFIRGSVVRYVQLPP+GVD+ELLHDATRREARGG Sbjct: 437 ENTRVVDQDKYPHMLSVRNCFIRGSVVRYVQLPPEGVDIELLHDATRREARGG 489 >emb|CBI32330.3| unnamed protein product [Vitis vinifera] Length = 137 Score = 107 bits (266), Expect = 2e-21 Identities = 49/53 (92%), Positives = 52/53 (98%) Frame = -2 Query: 405 ENTRVVDEDKYPHMRSVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG 247 ENTRVVD+DKYPHM SVRNCFIRGSVVRYVQLPP+GVD+ELLHDATRREARGG Sbjct: 85 ENTRVVDQDKYPHMLSVRNCFIRGSVVRYVQLPPEGVDIELLHDATRREARGG 137 >ref|XP_003625831.1| SnRNP core Sm protein Sm-X5-like protein [Medicago truncatula] gi|355500846|gb|AES82049.1| SnRNP core Sm protein Sm-X5-like protein [Medicago truncatula] gi|388519597|gb|AFK47860.1| unknown [Lotus japonicus] Length = 93 Score = 107 bits (266), Expect = 2e-21 Identities = 49/53 (92%), Positives = 52/53 (98%) Frame = -2 Query: 405 ENTRVVDEDKYPHMRSVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG 247 ENTRVVD+DKYPHM SVRNCFIRGSVVRYVQLPP+GVD+ELLHDATRREARGG Sbjct: 41 ENTRVVDQDKYPHMLSVRNCFIRGSVVRYVQLPPEGVDIELLHDATRREARGG 93 >ref|XP_002304049.1| small nuclear ribonucleoprotein D [Populus trichocarpa] gi|224118384|ref|XP_002331469.1| predicted protein [Populus trichocarpa] gi|118484877|gb|ABK94305.1| unknown [Populus trichocarpa] gi|222841481|gb|EEE79028.1| small nuclear ribonucleoprotein D [Populus trichocarpa] Length = 93 Score = 106 bits (264), Expect = 4e-21 Identities = 49/53 (92%), Positives = 52/53 (98%) Frame = -2 Query: 405 ENTRVVDEDKYPHMRSVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG 247 ENTRVVD+DKYPHM SVRNCFIRGSVVRYVQLPP+GVDV+LLHDATRREARGG Sbjct: 41 ENTRVVDQDKYPHMLSVRNCFIRGSVVRYVQLPPEGVDVDLLHDATRREARGG 93 >gb|ABK93861.1| unknown [Populus trichocarpa] Length = 93 Score = 106 bits (264), Expect = 4e-21 Identities = 49/53 (92%), Positives = 52/53 (98%) Frame = -2 Query: 405 ENTRVVDEDKYPHMRSVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG 247 ENTRVVD+DKYPHM SVRNCFIRGSVVRYVQLPP+GVDV+LLHDATRREARGG Sbjct: 41 ENTRVVDQDKYPHMLSVRNCFIRGSVVRYVQLPPEGVDVDLLHDATRREARGG 93 >ref|XP_006305805.1| hypothetical protein CARUB_v10010754mg [Capsella rubella] gi|567156028|ref|XP_006418245.1| hypothetical protein EUTSA_v10009199mg [Eutrema salsugineum] gi|482574516|gb|EOA38703.1| hypothetical protein CARUB_v10010754mg [Capsella rubella] gi|557096016|gb|ESQ36598.1| hypothetical protein EUTSA_v10009199mg [Eutrema salsugineum] Length = 93 Score = 105 bits (263), Expect = 5e-21 Identities = 49/53 (92%), Positives = 51/53 (96%) Frame = -2 Query: 405 ENTRVVDEDKYPHMRSVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG 247 ENTRVVD+DKYPHM SVRNCFIRGSVVRYVQLPPDGVDV+LLHDA RREARGG Sbjct: 41 ENTRVVDQDKYPHMLSVRNCFIRGSVVRYVQLPPDGVDVDLLHDAARREARGG 93 >gb|EMJ13495.1| hypothetical protein PRUPE_ppa013967mg [Prunus persica] Length = 93 Score = 105 bits (263), Expect = 5e-21 Identities = 49/53 (92%), Positives = 52/53 (98%) Frame = -2 Query: 405 ENTRVVDEDKYPHMRSVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG 247 ENTRVVD++KYPHM SVRNCFIRGSVVRYVQLPP+GVDVELLHDATRREARGG Sbjct: 41 ENTRVVDQEKYPHMLSVRNCFIRGSVVRYVQLPPEGVDVELLHDATRREARGG 93