BLASTX nr result
ID: Achyranthes23_contig00009728
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00009728 (306 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002322017.2| cyclic nucleotide-gated channel C family pro... 64 2e-08 ref|XP_002317760.1| cyclic nucleotide-gated channel C family pro... 61 2e-07 ref|XP_002513573.1| Cyclic nucleotide-gated ion channel, putativ... 57 3e-06 gb|EMJ21428.1| hypothetical protein PRUPE_ppa002135mg [Prunus pe... 56 6e-06 ref|XP_002268992.1| PREDICTED: cyclic nucleotide-gated ion chann... 55 1e-05 >ref|XP_002322017.2| cyclic nucleotide-gated channel C family protein [Populus trichocarpa] gi|550321788|gb|EEF06144.2| cyclic nucleotide-gated channel C family protein [Populus trichocarpa] Length = 705 Score = 63.9 bits (154), Expect = 2e-08 Identities = 34/83 (40%), Positives = 51/83 (61%), Gaps = 1/83 (1%) Frame = +2 Query: 59 MNFEKEKFVRFQDWVPPKRVDGQFYIQDDVCFGNFRRSLGSFSDNLKRGWGAFPQSFKRI 238 MN +EKFVRFQDW K +G++ + + G R ++ S S+ ++RG + SF+RI Sbjct: 1 MNQPQEKFVRFQDWKSEKTTEGRYSASNGIYPGKIRTTISSVSEKVQRGLESGSASFRRI 60 Query: 239 GKFLRAR-FLLEAWSKKKVLDPQ 304 K L++ F E SK+K+LDPQ Sbjct: 61 SKSLKSHSFNSEFASKQKILDPQ 83 >ref|XP_002317760.1| cyclic nucleotide-gated channel C family protein [Populus trichocarpa] gi|222858433|gb|EEE95980.1| cyclic nucleotide-gated channel C family protein [Populus trichocarpa] Length = 709 Score = 60.8 bits (146), Expect = 2e-07 Identities = 33/83 (39%), Positives = 48/83 (57%), Gaps = 1/83 (1%) Frame = +2 Query: 59 MNFEKEKFVRFQDWVPPKRVDGQFYIQDDVCFGNFRRSLGSFSDNLKRGWGAFPQSFKRI 238 MN +EKFVRFQDW K +G + + + G R ++ S S+ +RG + SF +I Sbjct: 1 MNHPQEKFVRFQDWKSEKSTEGNYSASNVMYPGKIRTTISSVSEKFQRGLESGSSSFNKI 60 Query: 239 GKFLRA-RFLLEAWSKKKVLDPQ 304 K L++ F E S+KK+LDPQ Sbjct: 61 RKSLKSYSFNSEVASRKKILDPQ 83 >ref|XP_002513573.1| Cyclic nucleotide-gated ion channel, putative [Ricinus communis] gi|223547481|gb|EEF48976.1| Cyclic nucleotide-gated ion channel, putative [Ricinus communis] Length = 838 Score = 57.0 bits (136), Expect = 3e-06 Identities = 32/87 (36%), Positives = 48/87 (55%), Gaps = 5/87 (5%) Frame = +2 Query: 59 MNFEKEKFVRFQDWVPPKRVDGQFYIQDDVCFGNFRRSLGSFSDNLKRGWGAFPQSFKRI 238 MN+ +EKFVRFQDW K ++ Q+ + D + R S+ S S+ +RG + + KRI Sbjct: 1 MNYSQEKFVRFQDWRSEKSMETQYSVSDGIHSRKIRMSITSVSEKFQRGLESGSERIKRI 60 Query: 239 GKFLRARFLLEAWSK-----KKVLDPQ 304 K L++ A +K K+LDPQ Sbjct: 61 RKSLKSYSFGSAVTKGLNSGNKILDPQ 87 >gb|EMJ21428.1| hypothetical protein PRUPE_ppa002135mg [Prunus persica] Length = 711 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/82 (35%), Positives = 45/82 (54%) Frame = +2 Query: 59 MNFEKEKFVRFQDWVPPKRVDGQFYIQDDVCFGNFRRSLGSFSDNLKRGWGAFPQSFKRI 238 MNF +EKFVRFQDW K+V+ + D++ G FRR++ S S +RG + + K+ Sbjct: 1 MNFHQEKFVRFQDWTSEKKVEPLYSPDDEIHAGKFRRTIHSVSMKFQRGLESGSERIKKS 60 Query: 239 GKFLRARFLLEAWSKKKVLDPQ 304 K ++ ++LDPQ Sbjct: 61 WKSYSFDGVIAKSFGSRILDPQ 82 >ref|XP_002268992.1| PREDICTED: cyclic nucleotide-gated ion channel 1 [Vitis vinifera] gi|302143681|emb|CBI22542.3| unnamed protein product [Vitis vinifera] Length = 709 Score = 55.1 bits (131), Expect = 1e-05 Identities = 32/85 (37%), Positives = 46/85 (54%), Gaps = 3/85 (3%) Frame = +2 Query: 59 MNFEKEKFVRFQDWVPPKRVDGQFYIQDDVCFGNFRRSLGSFSDNLKRGWGAFPQSFKRI 238 MN+ +EKFVRFQDW + +G+ I + V G R ++ S S +RG + I Sbjct: 1 MNYRQEKFVRFQDWSSERSSEGKIPINNGVRSGKIRLAINSVSGKFQRGLECGSERINSI 60 Query: 239 GKFLRA---RFLLEAWSKKKVLDPQ 304 + L++ R LE S KK+LDPQ Sbjct: 61 RRSLKSFSFRRNLEKGSGKKILDPQ 85