BLASTX nr result
ID: Achyranthes23_contig00009699
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00009699 (435 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002530343.1| valacyclovir hydrolase, putative [Ricinus co... 56 4e-06 >ref|XP_002530343.1| valacyclovir hydrolase, putative [Ricinus communis] gi|223530147|gb|EEF32059.1| valacyclovir hydrolase, putative [Ricinus communis] Length = 317 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/41 (65%), Positives = 32/41 (78%), Gaps = 3/41 (7%) Frame = -2 Query: 353 RVLKNTSFE---NSIEKPYDSTAFVLHGLLGCGRNWRSFAR 240 R L+ +FE +S EKPY STAF+LHGLLG GRNWRSF+R Sbjct: 20 RTLETLAFEEVRSSPEKPYTSTAFILHGLLGSGRNWRSFSR 60