BLASTX nr result
ID: Achyranthes23_contig00009420
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00009420 (218 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002285529.1| PREDICTED: septum-promoting GTP-binding prot... 79 8e-13 emb|CAN60928.1| hypothetical protein VITISV_008356 [Vitis vinife... 79 8e-13 gb|EXB50264.1| Septum-promoting GTP-binding protein 1 [Morus not... 77 2e-12 ref|XP_006352632.1| PREDICTED: septum-promoting GTP-binding prot... 77 2e-12 gb|EOY12470.1| Ras-related small GTP-binding family protein isof... 77 2e-12 gb|EOY12469.1| Ras-related small GTP-binding family protein isof... 77 2e-12 ref|XP_006493948.1| PREDICTED: septum-promoting GTP-binding prot... 77 2e-12 ref|XP_006452226.1| hypothetical protein CICLE_v10009122mg [Citr... 77 2e-12 ref|XP_002319823.1| predicted protein [Populus trichocarpa] gi|5... 77 2e-12 ref|XP_002523001.1| sgp1 monomeric G-protein, putative [Ricinus ... 76 4e-12 ref|XP_006366045.1| PREDICTED: septum-promoting GTP-binding prot... 75 7e-12 ref|XP_004244140.1| PREDICTED: septum-promoting GTP-binding prot... 75 7e-12 ref|XP_004957887.1| PREDICTED: septum-promoting GTP-binding prot... 75 9e-12 ref|XP_002460793.1| hypothetical protein SORBIDRAFT_02g034970 [S... 75 9e-12 ref|XP_002317584.1| hypothetical protein POPTR_0011s13960g [Popu... 75 9e-12 ref|NP_001151110.1| septum-promoting GTP-binding protein 1 [Zea ... 75 9e-12 ref|XP_006657773.1| PREDICTED: septum-promoting GTP-binding prot... 75 1e-11 gb|ESW14246.1| hypothetical protein PHAVU_008G265300g [Phaseolus... 75 1e-11 ref|XP_004491360.1| PREDICTED: septum-promoting GTP-binding prot... 75 1e-11 gb|EMS47681.1| Septum-promoting GTP-binding protein 1 [Triticum ... 75 1e-11 >ref|XP_002285529.1| PREDICTED: septum-promoting GTP-binding protein 1 [Vitis vinifera] Length = 282 Score = 78.6 bits (192), Expect = 8e-13 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +1 Query: 1 HNINVNKIFKFIMAKLFNLPWTVQRNLTIGEPIIDF 108 HNINVNKIFKFIMAKLFNLPWTVQRNLTIGEPIIDF Sbjct: 247 HNINVNKIFKFIMAKLFNLPWTVQRNLTIGEPIIDF 282 >emb|CAN60928.1| hypothetical protein VITISV_008356 [Vitis vinifera] gi|302142871|emb|CBI20166.3| unnamed protein product [Vitis vinifera] Length = 277 Score = 78.6 bits (192), Expect = 8e-13 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +1 Query: 1 HNINVNKIFKFIMAKLFNLPWTVQRNLTIGEPIIDF 108 HNINVNKIFKFIMAKLFNLPWTVQRNLTIGEPIIDF Sbjct: 242 HNINVNKIFKFIMAKLFNLPWTVQRNLTIGEPIIDF 277 >gb|EXB50264.1| Septum-promoting GTP-binding protein 1 [Morus notabilis] Length = 289 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = +1 Query: 1 HNINVNKIFKFIMAKLFNLPWTVQRNLTIGEPIIDF 108 HNINVNKIFKFIMAKLFNLPWTV+RNLTIGEPIIDF Sbjct: 254 HNINVNKIFKFIMAKLFNLPWTVERNLTIGEPIIDF 289 >ref|XP_006352632.1| PREDICTED: septum-promoting GTP-binding protein 1-like [Solanum tuberosum] Length = 247 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = +1 Query: 1 HNINVNKIFKFIMAKLFNLPWTVQRNLTIGEPIIDF 108 HNINVNKIFKFIMAKLFNLPWTVQ+NLTIGEPIIDF Sbjct: 212 HNINVNKIFKFIMAKLFNLPWTVQKNLTIGEPIIDF 247 >gb|EOY12470.1| Ras-related small GTP-binding family protein isoform 2 [Theobroma cacao] Length = 282 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = +1 Query: 1 HNINVNKIFKFIMAKLFNLPWTVQRNLTIGEPIIDF 108 HNINVNKIFKFIMAKLFNLPWTV+RNLTIGEPIIDF Sbjct: 247 HNINVNKIFKFIMAKLFNLPWTVERNLTIGEPIIDF 282 >gb|EOY12469.1| Ras-related small GTP-binding family protein isoform 1 [Theobroma cacao] Length = 315 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = +1 Query: 1 HNINVNKIFKFIMAKLFNLPWTVQRNLTIGEPIIDF 108 HNINVNKIFKFIMAKLFNLPWTV+RNLTIGEPIIDF Sbjct: 280 HNINVNKIFKFIMAKLFNLPWTVERNLTIGEPIIDF 315 >ref|XP_006493948.1| PREDICTED: septum-promoting GTP-binding protein 1-like [Citrus sinensis] Length = 284 Score = 77.0 bits (188), Expect = 2e-12 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = +1 Query: 1 HNINVNKIFKFIMAKLFNLPWTVQRNLTIGEPIIDF 108 HNINVNKIFKFIMAKLFNLPWTV+RNLTIGEPIIDF Sbjct: 249 HNINVNKIFKFIMAKLFNLPWTVKRNLTIGEPIIDF 284 >ref|XP_006452226.1| hypothetical protein CICLE_v10009122mg [Citrus clementina] gi|557555452|gb|ESR65466.1| hypothetical protein CICLE_v10009122mg [Citrus clementina] Length = 284 Score = 77.0 bits (188), Expect = 2e-12 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = +1 Query: 1 HNINVNKIFKFIMAKLFNLPWTVQRNLTIGEPIIDF 108 HNINVNKIFKFIMAKLFNLPWTV+RNLTIGEPIIDF Sbjct: 249 HNINVNKIFKFIMAKLFNLPWTVKRNLTIGEPIIDF 284 >ref|XP_002319823.1| predicted protein [Populus trichocarpa] gi|566154884|ref|XP_006370664.1| hypothetical protein POPTR_0001s44670g [Populus trichocarpa] gi|550349870|gb|ERP67233.1| hypothetical protein POPTR_0001s44670g [Populus trichocarpa] Length = 279 Score = 77.0 bits (188), Expect = 2e-12 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = +1 Query: 1 HNINVNKIFKFIMAKLFNLPWTVQRNLTIGEPIIDF 108 HNINVNKIFKFIMAKLFNLPWTV+RNLT+GEPIIDF Sbjct: 244 HNINVNKIFKFIMAKLFNLPWTVERNLTVGEPIIDF 279 >ref|XP_002523001.1| sgp1 monomeric G-protein, putative [Ricinus communis] gi|223537813|gb|EEF39431.1| sgp1 monomeric G-protein, putative [Ricinus communis] Length = 245 Score = 76.3 bits (186), Expect = 4e-12 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = +1 Query: 1 HNINVNKIFKFIMAKLFNLPWTVQRNLTIGEPIIDF 108 HNINVNKIFKFIMAKLFNLPWT++RNLTIGEPIIDF Sbjct: 210 HNINVNKIFKFIMAKLFNLPWTLERNLTIGEPIIDF 245 >ref|XP_006366045.1| PREDICTED: septum-promoting GTP-binding protein 1-like [Solanum tuberosum] Length = 289 Score = 75.5 bits (184), Expect = 7e-12 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = +1 Query: 1 HNINVNKIFKFIMAKLFNLPWTVQRNLTIGEPIIDF 108 HNINVNKIFKFIMAKLFNLPW+V+RNLTIGEPIIDF Sbjct: 254 HNINVNKIFKFIMAKLFNLPWSVKRNLTIGEPIIDF 289 >ref|XP_004244140.1| PREDICTED: septum-promoting GTP-binding protein 1-like [Solanum lycopersicum] Length = 289 Score = 75.5 bits (184), Expect = 7e-12 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = +1 Query: 1 HNINVNKIFKFIMAKLFNLPWTVQRNLTIGEPIIDF 108 HNINVNKIFKFIMAKLFNLPW+V+RNLTIGEPIIDF Sbjct: 254 HNINVNKIFKFIMAKLFNLPWSVKRNLTIGEPIIDF 289 >ref|XP_004957887.1| PREDICTED: septum-promoting GTP-binding protein 1-like [Setaria italica] Length = 313 Score = 75.1 bits (183), Expect = 9e-12 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +1 Query: 1 HNINVNKIFKFIMAKLFNLPWTVQRNLTIGEPIIDF 108 HNINVNKIFKFI AKLFNLPWTV+RNLTIGEPIIDF Sbjct: 278 HNINVNKIFKFITAKLFNLPWTVERNLTIGEPIIDF 313 >ref|XP_002460793.1| hypothetical protein SORBIDRAFT_02g034970 [Sorghum bicolor] gi|241924170|gb|EER97314.1| hypothetical protein SORBIDRAFT_02g034970 [Sorghum bicolor] Length = 154 Score = 75.1 bits (183), Expect = 9e-12 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +1 Query: 1 HNINVNKIFKFIMAKLFNLPWTVQRNLTIGEPIIDF 108 HNINVNKIFKFI AKLFNLPWTV+RNLTIGEPIIDF Sbjct: 119 HNINVNKIFKFITAKLFNLPWTVERNLTIGEPIIDF 154 >ref|XP_002317584.1| hypothetical protein POPTR_0011s13960g [Populus trichocarpa] gi|222860649|gb|EEE98196.1| hypothetical protein POPTR_0011s13960g [Populus trichocarpa] Length = 278 Score = 75.1 bits (183), Expect = 9e-12 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +1 Query: 1 HNINVNKIFKFIMAKLFNLPWTVQRNLTIGEPIIDF 108 HNINVNKIFKFIMAKL NLPWTV+RNLTIGEPIIDF Sbjct: 243 HNINVNKIFKFIMAKLLNLPWTVERNLTIGEPIIDF 278 >ref|NP_001151110.1| septum-promoting GTP-binding protein 1 [Zea mays] gi|195644366|gb|ACG41651.1| septum-promoting GTP-binding protein 1 [Zea mays] gi|414590446|tpg|DAA41017.1| TPA: septum-promoting GTP-binding protein 1 [Zea mays] Length = 300 Score = 75.1 bits (183), Expect = 9e-12 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +1 Query: 1 HNINVNKIFKFIMAKLFNLPWTVQRNLTIGEPIIDF 108 HNINVNKIFKFI AKLFNLPWTV+RNLTIGEPIIDF Sbjct: 265 HNINVNKIFKFITAKLFNLPWTVERNLTIGEPIIDF 300 >ref|XP_006657773.1| PREDICTED: septum-promoting GTP-binding protein 1-like [Oryza brachyantha] Length = 169 Score = 74.7 bits (182), Expect = 1e-11 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = +1 Query: 1 HNINVNKIFKFIMAKLFNLPWTVQRNLTIGEPIIDF 108 HNINVNKIFKFI AKLFNLPWTV+RNLT+GEPIIDF Sbjct: 134 HNINVNKIFKFITAKLFNLPWTVERNLTVGEPIIDF 169 >gb|ESW14246.1| hypothetical protein PHAVU_008G265300g [Phaseolus vulgaris] Length = 279 Score = 74.7 bits (182), Expect = 1e-11 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = +1 Query: 1 HNINVNKIFKFIMAKLFNLPWTVQRNLTIGEPIIDF 108 HNINVNKIFKFIMAKLFNLPWTV+RNL +GEPIIDF Sbjct: 244 HNINVNKIFKFIMAKLFNLPWTVERNLRVGEPIIDF 279 >ref|XP_004491360.1| PREDICTED: septum-promoting GTP-binding protein 1-like [Cicer arietinum] Length = 278 Score = 74.7 bits (182), Expect = 1e-11 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = +1 Query: 1 HNINVNKIFKFIMAKLFNLPWTVQRNLTIGEPIIDF 108 HNINVNKIFKFIMAKLFNLPWTV+RNL +GEPIIDF Sbjct: 243 HNINVNKIFKFIMAKLFNLPWTVERNLKVGEPIIDF 278 >gb|EMS47681.1| Septum-promoting GTP-binding protein 1 [Triticum urartu] Length = 204 Score = 74.7 bits (182), Expect = 1e-11 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = +1 Query: 1 HNINVNKIFKFIMAKLFNLPWTVQRNLTIGEPIIDF 108 HNINVNKIFKFI AKLFNLPWTV+RNLT+GEPIIDF Sbjct: 169 HNINVNKIFKFITAKLFNLPWTVERNLTVGEPIIDF 204