BLASTX nr result
ID: Achyranthes23_contig00009363
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00009363 (202 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002266418.2| PREDICTED: putative disease resistance prote... 55 7e-06 emb|CBI21772.3| unnamed protein product [Vitis vinifera] 55 7e-06 >ref|XP_002266418.2| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera] Length = 1177 Score = 55.5 bits (132), Expect = 7e-06 Identities = 31/58 (53%), Positives = 37/58 (63%) Frame = -3 Query: 200 DNLTHMPSGIKGLTLLHKLPLFIVNHKQSAELRKKPTRTAKLSDLKNLNNLRGILSLK 27 DNLTHMP GI LTLL LPLFIV + + K R +LS+LK L+ L GIL +K Sbjct: 645 DNLTHMPCGIGELTLLQSLPLFIVGNGREFSKNK---RIGRLSELKRLSQLGGILQIK 699 >emb|CBI21772.3| unnamed protein product [Vitis vinifera] Length = 826 Score = 55.5 bits (132), Expect = 7e-06 Identities = 31/58 (53%), Positives = 37/58 (63%) Frame = -3 Query: 200 DNLTHMPSGIKGLTLLHKLPLFIVNHKQSAELRKKPTRTAKLSDLKNLNNLRGILSLK 27 DNLTHMP GI LTLL LPLFIV + + K R +LS+LK L+ L GIL +K Sbjct: 414 DNLTHMPCGIGELTLLQSLPLFIVGNGREFSKNK---RIGRLSELKRLSQLGGILQIK 468