BLASTX nr result
ID: Achyranthes23_contig00009132
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00009132 (616 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003590744.1| Pentatricopeptide repeat-containing protein ... 106 5e-21 ref|XP_003535453.2| PREDICTED: pentatricopeptide repeat-containi... 105 1e-20 ref|XP_004495263.1| PREDICTED: pentatricopeptide repeat-containi... 105 1e-20 ref|XP_004301492.1| PREDICTED: pentatricopeptide repeat-containi... 105 1e-20 emb|CBI19832.3| unnamed protein product [Vitis vinifera] 104 2e-20 ref|XP_002280360.1| PREDICTED: pentatricopeptide repeat-containi... 104 2e-20 gb|ESW16129.1| hypothetical protein PHAVU_007G131600g [Phaseolus... 103 3e-20 gb|EMJ17324.1| hypothetical protein PRUPE_ppa018932mg [Prunus pe... 102 7e-20 ref|XP_002302000.2| pentatricopeptide repeat-containing family p... 102 9e-20 gb|EXB53614.1| hypothetical protein L484_005164 [Morus notabilis] 101 1e-19 ref|XP_004152758.1| PREDICTED: pentatricopeptide repeat-containi... 101 2e-19 gb|EMJ17597.1| hypothetical protein PRUPE_ppa022530mg [Prunus pe... 100 3e-19 ref|XP_006473595.1| PREDICTED: pentatricopeptide repeat-containi... 100 4e-19 ref|XP_006435103.1| hypothetical protein CICLE_v10000322mg [Citr... 100 4e-19 gb|EOY05619.1| Pentatricopeptide repeat (PPR) superfamily protei... 100 4e-19 ref|XP_004167110.1| PREDICTED: pentatricopeptide repeat-containi... 100 6e-19 emb|CAJ26357.1| Selenium binding protein [Brachypodium sylvaticum] 99 9e-19 ref|XP_006342194.1| PREDICTED: pentatricopeptide repeat-containi... 98 2e-18 ref|XP_004238467.1| PREDICTED: pentatricopeptide repeat-containi... 98 2e-18 ref|XP_002281998.2| PREDICTED: pentatricopeptide repeat-containi... 98 2e-18 >ref|XP_003590744.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355479792|gb|AES60995.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 795 Score = 106 bits (265), Expect = 5e-21 Identities = 44/53 (83%), Positives = 50/53 (94%) Frame = +1 Query: 4 GATVRVFKNLRICGDCHNAIKYISKIVQRVIIVRDVKRFHHFRNGECSCGDYW 162 GAT+RVFKNLRICGDCHNA KYISK+V+R I+VRD KRFHHF+NGECSCG+YW Sbjct: 743 GATIRVFKNLRICGDCHNAFKYISKVVEREIVVRDRKRFHHFKNGECSCGNYW 795 >ref|XP_003535453.2| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like [Glycine max] Length = 787 Score = 105 bits (261), Expect = 1e-20 Identities = 45/53 (84%), Positives = 48/53 (90%) Frame = +1 Query: 4 GATVRVFKNLRICGDCHNAIKYISKIVQRVIIVRDVKRFHHFRNGECSCGDYW 162 GAT+RVFKNLRICGDCHNA KYISK+V R IIVRD KRFHHFRNGECSC +YW Sbjct: 735 GATIRVFKNLRICGDCHNAFKYISKVVDREIIVRDRKRFHHFRNGECSCSNYW 787 >ref|XP_004495263.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like [Cicer arietinum] Length = 795 Score = 105 bits (261), Expect = 1e-20 Identities = 44/53 (83%), Positives = 49/53 (92%) Frame = +1 Query: 4 GATVRVFKNLRICGDCHNAIKYISKIVQRVIIVRDVKRFHHFRNGECSCGDYW 162 GAT+RVFKNLRICGDCHNA K+ISK+V R I+VRD KRFHHFRNGECSCG+YW Sbjct: 743 GATIRVFKNLRICGDCHNAFKFISKVVAREIVVRDRKRFHHFRNGECSCGNYW 795 >ref|XP_004301492.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like, partial [Fragaria vesca subsp. vesca] Length = 800 Score = 105 bits (261), Expect = 1e-20 Identities = 43/53 (81%), Positives = 49/53 (92%) Frame = +1 Query: 4 GATVRVFKNLRICGDCHNAIKYISKIVQRVIIVRDVKRFHHFRNGECSCGDYW 162 GAT+RVFKNLRICGDCHNA KY+S++V R I+VRD KRFHHFRNGECSCG+YW Sbjct: 748 GATIRVFKNLRICGDCHNAFKYMSRVVGREIVVRDAKRFHHFRNGECSCGNYW 800 >emb|CBI19832.3| unnamed protein product [Vitis vinifera] Length = 544 Score = 104 bits (259), Expect = 2e-20 Identities = 43/53 (81%), Positives = 50/53 (94%) Frame = +1 Query: 4 GATVRVFKNLRICGDCHNAIKYISKIVQRVIIVRDVKRFHHFRNGECSCGDYW 162 GATVRVFKNLRICGDCHNA K++SK+V+R I+VRD KRFHHF+NGECSCG+YW Sbjct: 492 GATVRVFKNLRICGDCHNAFKFMSKVVEREIVVRDGKRFHHFKNGECSCGNYW 544 >ref|XP_002280360.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Vitis vinifera] Length = 799 Score = 104 bits (259), Expect = 2e-20 Identities = 43/53 (81%), Positives = 50/53 (94%) Frame = +1 Query: 4 GATVRVFKNLRICGDCHNAIKYISKIVQRVIIVRDVKRFHHFRNGECSCGDYW 162 GATVRVFKNLRICGDCHNA K++SK+V+R I+VRD KRFHHF+NGECSCG+YW Sbjct: 747 GATVRVFKNLRICGDCHNAFKFMSKVVEREIVVRDGKRFHHFKNGECSCGNYW 799 >gb|ESW16129.1| hypothetical protein PHAVU_007G131600g [Phaseolus vulgaris] Length = 787 Score = 103 bits (258), Expect = 3e-20 Identities = 44/53 (83%), Positives = 49/53 (92%) Frame = +1 Query: 4 GATVRVFKNLRICGDCHNAIKYISKIVQRVIIVRDVKRFHHFRNGECSCGDYW 162 GAT+RVFKNLRICGDCH+A K+ISK+V R IIVRD KRFHHFRNGECSCG+YW Sbjct: 735 GATIRVFKNLRICGDCHSAFKFISKVVDREIIVRDRKRFHHFRNGECSCGNYW 787 >gb|EMJ17324.1| hypothetical protein PRUPE_ppa018932mg [Prunus persica] Length = 689 Score = 102 bits (255), Expect = 7e-20 Identities = 43/53 (81%), Positives = 49/53 (92%) Frame = +1 Query: 4 GATVRVFKNLRICGDCHNAIKYISKIVQRVIIVRDVKRFHHFRNGECSCGDYW 162 GAT+RVFKNLRICGDCH AIK++S++V R IIVRD KRFHHFRNGECSCG+YW Sbjct: 637 GATIRVFKNLRICGDCHTAIKFMSRVVGRDIIVRDAKRFHHFRNGECSCGNYW 689 >ref|XP_002302000.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550344162|gb|EEE81273.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 797 Score = 102 bits (254), Expect = 9e-20 Identities = 43/53 (81%), Positives = 49/53 (92%) Frame = +1 Query: 4 GATVRVFKNLRICGDCHNAIKYISKIVQRVIIVRDVKRFHHFRNGECSCGDYW 162 GATVRVFKNLRICGDCHNA K++SK+V R I+VRD KRFHHFR+G+CSCGDYW Sbjct: 745 GATVRVFKNLRICGDCHNAFKFMSKVVGREIVVRDGKRFHHFRDGKCSCGDYW 797 >gb|EXB53614.1| hypothetical protein L484_005164 [Morus notabilis] Length = 800 Score = 101 bits (252), Expect = 1e-19 Identities = 41/53 (77%), Positives = 49/53 (92%) Frame = +1 Query: 4 GATVRVFKNLRICGDCHNAIKYISKIVQRVIIVRDVKRFHHFRNGECSCGDYW 162 GAT+RVFKNLRICGDCHNA ++S++V+R I+VRD KRFHHFRNGECSCG+YW Sbjct: 748 GATIRVFKNLRICGDCHNAFMFMSRVVEREIVVRDGKRFHHFRNGECSCGNYW 800 >ref|XP_004152758.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like [Cucumis sativus] gi|449504088|ref|XP_004162249.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like [Cucumis sativus] Length = 797 Score = 101 bits (251), Expect = 2e-19 Identities = 43/53 (81%), Positives = 49/53 (92%) Frame = +1 Query: 4 GATVRVFKNLRICGDCHNAIKYISKIVQRVIIVRDVKRFHHFRNGECSCGDYW 162 GATVRVFKNLRICGDCHNAIK++SK+V R I+VRD KRFHHF+NGECSC +YW Sbjct: 745 GATVRVFKNLRICGDCHNAIKFMSKVVGREIVVRDGKRFHHFKNGECSCRNYW 797 >gb|EMJ17597.1| hypothetical protein PRUPE_ppa022530mg [Prunus persica] Length = 689 Score = 100 bits (249), Expect = 3e-19 Identities = 42/53 (79%), Positives = 48/53 (90%) Frame = +1 Query: 4 GATVRVFKNLRICGDCHNAIKYISKIVQRVIIVRDVKRFHHFRNGECSCGDYW 162 GAT+RVFKNLR CGDCH AIK++S++V R IIVRD KRFHHFRNGECSCG+YW Sbjct: 637 GATIRVFKNLRSCGDCHTAIKFMSRVVGRDIIVRDAKRFHHFRNGECSCGNYW 689 >ref|XP_006473595.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like isoform X1 [Citrus sinensis] gi|568839239|ref|XP_006473596.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like isoform X2 [Citrus sinensis] Length = 799 Score = 100 bits (248), Expect = 4e-19 Identities = 42/53 (79%), Positives = 48/53 (90%) Frame = +1 Query: 4 GATVRVFKNLRICGDCHNAIKYISKIVQRVIIVRDVKRFHHFRNGECSCGDYW 162 GATVRV KNLRICGDCHNA K++SK+V R I+VRD KRFHHFR+G+CSCGDYW Sbjct: 747 GATVRVLKNLRICGDCHNAFKFMSKVVGREIVVRDGKRFHHFRDGKCSCGDYW 799 >ref|XP_006435103.1| hypothetical protein CICLE_v10000322mg [Citrus clementina] gi|557537225|gb|ESR48343.1| hypothetical protein CICLE_v10000322mg [Citrus clementina] Length = 799 Score = 100 bits (248), Expect = 4e-19 Identities = 42/53 (79%), Positives = 48/53 (90%) Frame = +1 Query: 4 GATVRVFKNLRICGDCHNAIKYISKIVQRVIIVRDVKRFHHFRNGECSCGDYW 162 GATVRV KNLRICGDCHNA K++SK+V R I+VRD KRFHHFR+G+CSCGDYW Sbjct: 747 GATVRVLKNLRICGDCHNAFKFMSKVVGREIVVRDGKRFHHFRDGKCSCGDYW 799 >gb|EOY05619.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] Length = 788 Score = 100 bits (248), Expect = 4e-19 Identities = 43/53 (81%), Positives = 47/53 (88%) Frame = +1 Query: 4 GATVRVFKNLRICGDCHNAIKYISKIVQRVIIVRDVKRFHHFRNGECSCGDYW 162 GATVRVFKNLRICGDCHNA K++SK V R I+VRD KRFHHFR+ ECSCGDYW Sbjct: 736 GATVRVFKNLRICGDCHNAFKFMSKAVGREIVVRDAKRFHHFRDCECSCGDYW 788 >ref|XP_004167110.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like [Cucumis sativus] Length = 797 Score = 99.8 bits (247), Expect = 6e-19 Identities = 41/53 (77%), Positives = 48/53 (90%) Frame = +1 Query: 4 GATVRVFKNLRICGDCHNAIKYISKIVQRVIIVRDVKRFHHFRNGECSCGDYW 162 GATVRVFKN+RICGDCHNA K++SK+ +R IIVRD KRFHHF+NG+CSC DYW Sbjct: 745 GATVRVFKNIRICGDCHNAFKFMSKVARREIIVRDRKRFHHFKNGDCSCRDYW 797 >emb|CAJ26357.1| Selenium binding protein [Brachypodium sylvaticum] Length = 624 Score = 99.0 bits (245), Expect = 9e-19 Identities = 39/54 (72%), Positives = 46/54 (85%) Frame = +1 Query: 1 AGATVRVFKNLRICGDCHNAIKYISKIVQRVIIVRDVKRFHHFRNGECSCGDYW 162 AGAT+R+ KN+RICGDCH+A KYISK+ +R I+VRD RFHHF NG CSCGDYW Sbjct: 571 AGATIRIMKNIRICGDCHSAFKYISKVFEREIVVRDTNRFHHFSNGSCSCGDYW 624 >ref|XP_006342194.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like [Solanum tuberosum] Length = 804 Score = 98.2 bits (243), Expect = 2e-18 Identities = 41/53 (77%), Positives = 47/53 (88%) Frame = +1 Query: 4 GATVRVFKNLRICGDCHNAIKYISKIVQRVIIVRDVKRFHHFRNGECSCGDYW 162 GAT+RVFKNLRICGDCHNA K++SK+ R IIVRD RFHHFR+GECSCG+YW Sbjct: 752 GATIRVFKNLRICGDCHNAFKFMSKVEAREIIVRDGNRFHHFRDGECSCGNYW 804 >ref|XP_004238467.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like [Solanum lycopersicum] Length = 804 Score = 98.2 bits (243), Expect = 2e-18 Identities = 41/53 (77%), Positives = 47/53 (88%) Frame = +1 Query: 4 GATVRVFKNLRICGDCHNAIKYISKIVQRVIIVRDVKRFHHFRNGECSCGDYW 162 GAT+RVFKNLRICGDCHNA K++SK+ R IIVRD RFHHFR+GECSCG+YW Sbjct: 752 GATIRVFKNLRICGDCHNAFKFMSKVEAREIIVRDGNRFHHFRDGECSCGNYW 804 >ref|XP_002281998.2| PREDICTED: pentatricopeptide repeat-containing protein At4g33170 [Vitis vinifera] Length = 1580 Score = 97.8 bits (242), Expect = 2e-18 Identities = 39/54 (72%), Positives = 46/54 (85%) Frame = +1 Query: 1 AGATVRVFKNLRICGDCHNAIKYISKIVQRVIIVRDVKRFHHFRNGECSCGDYW 162 A T+RV KNLR+CGDCHNAIKYISK+ +R I++RD RFHHFR+G CSCGDYW Sbjct: 1527 ASTTIRVIKNLRVCGDCHNAIKYISKVFEREIVLRDANRFHHFRDGVCSCGDYW 1580