BLASTX nr result
ID: Achyranthes23_contig00008662
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00008662 (413 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY34661.1| Translocon at the inner envelope membrane of chlo... 56 6e-06 gb|EOY34660.1| Translocon at the inner envelope membrane of chlo... 56 6e-06 >gb|EOY34661.1| Translocon at the inner envelope membrane of chloroplasts 110 isoform 2 [Theobroma cacao] Length = 1015 Score = 55.8 bits (133), Expect = 6e-06 Identities = 33/69 (47%), Positives = 38/69 (55%) Frame = -2 Query: 208 SNSDRTTTTTNLSSSDIFGPPKELSGIQSLVDSLSPPXXXXXXXXXXXXXXXAGYGIGSR 29 S S TT T ++ DIFG PKEL+GIQ +V+ LSPP AGYGIG R Sbjct: 54 STSSTETTATTPTAPDIFGGPKELTGIQPVVEKLSPPLRVATSVVILAGALAAGYGIGLR 113 Query: 28 FGSGARNVA 2 G G RN A Sbjct: 114 LG-GNRNAA 121 >gb|EOY34660.1| Translocon at the inner envelope membrane of chloroplasts 110 isoform 1 [Theobroma cacao] Length = 1261 Score = 55.8 bits (133), Expect = 6e-06 Identities = 33/69 (47%), Positives = 38/69 (55%) Frame = -2 Query: 208 SNSDRTTTTTNLSSSDIFGPPKELSGIQSLVDSLSPPXXXXXXXXXXXXXXXAGYGIGSR 29 S S TT T ++ DIFG PKEL+GIQ +V+ LSPP AGYGIG R Sbjct: 54 STSSTETTATTPTAPDIFGGPKELTGIQPVVEKLSPPLRVATSVVILAGALAAGYGIGLR 113 Query: 28 FGSGARNVA 2 G G RN A Sbjct: 114 LG-GNRNAA 121