BLASTX nr result
ID: Achyranthes23_contig00008612
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00008612 (684 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006401487.1| hypothetical protein EUTSA_v10015094mg [Eutr... 160 4e-37 gb|EOX93329.1| Small ubiquitin-like modifier 1, 1,SUMO1,ATSUMO1,... 159 6e-37 ref|XP_002866079.1| hypothetical protein ARALYDRAFT_918658 [Arab... 159 6e-37 gb|AFP65785.1| SUMO peptide [Gossypium hirsutum] 159 1e-36 ref|XP_004304088.1| PREDICTED: small ubiquitin-related modifier ... 158 1e-36 gb|ESW18511.1| hypothetical protein PHAVU_006G047600g [Phaseolus... 158 2e-36 ref|XP_006281365.1| hypothetical protein CARUB_v10027422mg [Caps... 158 2e-36 ref|XP_002321150.1| Ubiquitin-like family protein [Populus trich... 157 2e-36 ref|XP_002301601.1| Ubiquitin-like family protein [Populus trich... 157 2e-36 ref|NP_200327.1| small ubiquitin-related modifier 2 [Arabidopsis... 157 3e-36 gb|EMJ13486.1| hypothetical protein PRUPE_ppa013880mg [Prunus pe... 156 6e-36 ref|XP_004150752.1| PREDICTED: small ubiquitin-related modifier ... 156 6e-36 ref|XP_002529470.1| conserved hypothetical protein [Ricinus comm... 155 8e-36 ref|XP_006447642.1| hypothetical protein CICLE_v10017283mg [Citr... 155 1e-35 gb|ABN05665.1| ubiquitin-like protein [Pisum sativum] 155 1e-35 ref|XP_004149348.1| PREDICTED: small ubiquitin-related modifier ... 154 2e-35 ref|XP_004513888.1| PREDICTED: small ubiquitin-related modifier ... 153 5e-35 gb|AFK36023.1| unknown [Lotus japonicus] 153 5e-35 ref|XP_003552121.1| PREDICTED: small ubiquitin-related modifier ... 152 7e-35 ref|NP_001235208.1| uncharacterized protein LOC100500241 [Glycin... 152 7e-35 >ref|XP_006401487.1| hypothetical protein EUTSA_v10015094mg [Eutrema salsugineum] gi|557102577|gb|ESQ42940.1| hypothetical protein EUTSA_v10015094mg [Eutrema salsugineum] Length = 104 Score = 160 bits (404), Expect = 4e-37 Identities = 80/94 (85%), Positives = 84/94 (89%), Gaps = 3/94 (3%) Frame = +2 Query: 77 MSGTQEQDQ---DQDKKHINLKVKGQDGNETFFRIKRSTQLKKLMNAYCDRQSVQFDSIA 247 MS TQE+D+ DQ HINLKVKGQDGNE FFRIKRSTQLKKLMNAYCDRQSV F+SIA Sbjct: 1 MSATQEEDKKPGDQGGAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDFNSIA 60 Query: 248 FLFDGRRLRVEQTPEELEMEDGDEIDAMLHQTGG 349 FLFDGRRLR EQTP+ELEMEDGDEIDAMLHQTGG Sbjct: 61 FLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGG 94 >gb|EOX93329.1| Small ubiquitin-like modifier 1, 1,SUMO1,ATSUMO1, partial [Theobroma cacao] Length = 133 Score = 159 bits (403), Expect = 6e-37 Identities = 80/98 (81%), Positives = 86/98 (87%), Gaps = 3/98 (3%) Frame = +2 Query: 65 NRATMSGTQEQDQ---DQDKKHINLKVKGQDGNETFFRIKRSTQLKKLMNAYCDRQSVQF 235 +R MSG QE+D+ DQ HINLKVKGQDGNE FFRIKRSTQLKKLMNAYCDRQSV+ Sbjct: 26 SRERMSGQQEEDKKPGDQSAAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVEL 85 Query: 236 DSIAFLFDGRRLRVEQTPEELEMEDGDEIDAMLHQTGG 349 +SIAFLFDGRRLR EQTP+ELEMEDGDEIDAMLHQTGG Sbjct: 86 NSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGG 123 >ref|XP_002866079.1| hypothetical protein ARALYDRAFT_918658 [Arabidopsis lyrata subsp. lyrata] gi|297311914|gb|EFH42338.1| hypothetical protein ARALYDRAFT_918658 [Arabidopsis lyrata subsp. lyrata] Length = 102 Score = 159 bits (403), Expect = 6e-37 Identities = 79/92 (85%), Positives = 84/92 (91%), Gaps = 1/92 (1%) Frame = +2 Query: 77 MSGTQEQDQDQDK-KHINLKVKGQDGNETFFRIKRSTQLKKLMNAYCDRQSVQFDSIAFL 253 MS TQE+D+ D+ HINLKVKGQDGNE FFRIKRSTQLKKLMNAYCDRQSV F+SIAFL Sbjct: 1 MSATQEEDKKPDQGAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDFNSIAFL 60 Query: 254 FDGRRLRVEQTPEELEMEDGDEIDAMLHQTGG 349 FDGRRLR EQTP+ELEMEDGDEIDAMLHQTGG Sbjct: 61 FDGRRLRAEQTPDELEMEDGDEIDAMLHQTGG 92 >gb|AFP65785.1| SUMO peptide [Gossypium hirsutum] Length = 96 Score = 159 bits (401), Expect = 1e-36 Identities = 80/95 (84%), Positives = 84/95 (88%), Gaps = 3/95 (3%) Frame = +2 Query: 77 MSGTQEQDQ---DQDKKHINLKVKGQDGNETFFRIKRSTQLKKLMNAYCDRQSVQFDSIA 247 MSG QE+D+ DQ HINLKVKGQDGNE FFRIKRSTQLKKLMNAYCDRQSV F+SIA Sbjct: 1 MSGQQEEDKKPGDQSAAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDFNSIA 60 Query: 248 FLFDGRRLRVEQTPEELEMEDGDEIDAMLHQTGGT 352 FLFDGRRLR EQTP+ELEMEDGDEI AMLHQTGGT Sbjct: 61 FLFDGRRLRGEQTPDELEMEDGDEIGAMLHQTGGT 95 >ref|XP_004304088.1| PREDICTED: small ubiquitin-related modifier 2-like [Fragaria vesca subsp. vesca] Length = 101 Score = 158 bits (400), Expect = 1e-36 Identities = 79/97 (81%), Positives = 84/97 (86%), Gaps = 6/97 (6%) Frame = +2 Query: 77 MSGTQEQDQDQDKK------HINLKVKGQDGNETFFRIKRSTQLKKLMNAYCDRQSVQFD 238 MSG Q Q++DKK HINLKVKGQDGNE FFRIKRSTQLKKLMNAYCDRQSV+ + Sbjct: 1 MSGVASQPQEEDKKPNDQGAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELN 60 Query: 239 SIAFLFDGRRLRVEQTPEELEMEDGDEIDAMLHQTGG 349 SIAFLFDGRRLR EQTP+ELEMEDGDEIDAMLHQTGG Sbjct: 61 SIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGG 97 >gb|ESW18511.1| hypothetical protein PHAVU_006G047600g [Phaseolus vulgaris] Length = 100 Score = 158 bits (399), Expect = 2e-36 Identities = 79/100 (79%), Positives = 85/100 (85%), Gaps = 6/100 (6%) Frame = +2 Query: 77 MSGTQEQDQDQDKK------HINLKVKGQDGNETFFRIKRSTQLKKLMNAYCDRQSVQFD 238 MSG + ++DKK HINLKVKGQDGNE FFRIKRSTQLKKLMNAYCDRQSV F+ Sbjct: 1 MSGVTNNNNEEDKKPSEQGAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDFN 60 Query: 239 SIAFLFDGRRLRVEQTPEELEMEDGDEIDAMLHQTGGT*F 358 SIAFLFDGRRLR EQTP+ELEMEDGDEIDAMLHQTGG+ F Sbjct: 61 SIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGSVF 100 >ref|XP_006281365.1| hypothetical protein CARUB_v10027422mg [Capsella rubella] gi|482550069|gb|EOA14263.1| hypothetical protein CARUB_v10027422mg [Capsella rubella] Length = 103 Score = 158 bits (399), Expect = 2e-36 Identities = 78/92 (84%), Positives = 84/92 (91%), Gaps = 1/92 (1%) Frame = +2 Query: 77 MSGTQEQDQDQDK-KHINLKVKGQDGNETFFRIKRSTQLKKLMNAYCDRQSVQFDSIAFL 253 MS T E+D+ D+ HINLKVKGQDGNE FFRIKRSTQLKKLMNAYCDRQSV+F+SIAFL Sbjct: 1 MSATPEEDKKPDQGAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVEFNSIAFL 60 Query: 254 FDGRRLRVEQTPEELEMEDGDEIDAMLHQTGG 349 FDGRRLR EQTP+ELEMEDGDEIDAMLHQTGG Sbjct: 61 FDGRRLRAEQTPDELEMEDGDEIDAMLHQTGG 92 >ref|XP_002321150.1| Ubiquitin-like family protein [Populus trichocarpa] gi|222861923|gb|EEE99465.1| Ubiquitin-like family protein [Populus trichocarpa] Length = 103 Score = 157 bits (398), Expect = 2e-36 Identities = 79/97 (81%), Positives = 85/97 (87%), Gaps = 6/97 (6%) Frame = +2 Query: 77 MSGTQEQDQDQDKK------HINLKVKGQDGNETFFRIKRSTQLKKLMNAYCDRQSVQFD 238 MSG Q Q++DKK HINLKVKGQDGNE FFRIKRSTQLKKLMNAYCDRQSV+F+ Sbjct: 1 MSGVTGQPQEEDKKPNDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVEFN 60 Query: 239 SIAFLFDGRRLRVEQTPEELEMEDGDEIDAMLHQTGG 349 SIAFLFDGRRLR EQTP+EL+MEDGDEIDAMLHQTGG Sbjct: 61 SIAFLFDGRRLRGEQTPDELDMEDGDEIDAMLHQTGG 97 >ref|XP_002301601.1| Ubiquitin-like family protein [Populus trichocarpa] gi|222843327|gb|EEE80874.1| Ubiquitin-like family protein [Populus trichocarpa] Length = 103 Score = 157 bits (398), Expect = 2e-36 Identities = 79/97 (81%), Positives = 85/97 (87%), Gaps = 6/97 (6%) Frame = +2 Query: 77 MSGTQEQDQDQDKK------HINLKVKGQDGNETFFRIKRSTQLKKLMNAYCDRQSVQFD 238 MSG Q Q++DKK HINLKVKGQDGNE FFRIKRSTQLKKLMNAYCDRQSV+F+ Sbjct: 1 MSGATGQPQEEDKKPNDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVEFN 60 Query: 239 SIAFLFDGRRLRVEQTPEELEMEDGDEIDAMLHQTGG 349 SIAFLFDGRRLR EQTP+EL+MEDGDEIDAMLHQTGG Sbjct: 61 SIAFLFDGRRLRGEQTPDELDMEDGDEIDAMLHQTGG 97 >ref|NP_200327.1| small ubiquitin-related modifier 2 [Arabidopsis thaliana] gi|75171511|sp|Q9FLP6.1|SUMO2_ARATH RecName: Full=Small ubiquitin-related modifier 2; Short=AtSUMO2 gi|9758113|dbj|BAB08585.1| ubiquitin-like protein SMT3-like [Arabidopsis thaliana] gi|19715611|gb|AAL91628.1| AT5g55160/MCO15_11 [Arabidopsis thaliana] gi|21360423|gb|AAM47327.1| AT5g55160/MCO15_11 [Arabidopsis thaliana] gi|21537401|gb|AAM61742.1| ubiquitin-like protein SMT3-like [Arabidopsis thaliana] gi|22652844|gb|AAN03846.1| small ubiquitin-like modifier 2 [Arabidopsis thaliana] gi|332009210|gb|AED96593.1| small ubiquitin-related modifier 2 [Arabidopsis thaliana] Length = 103 Score = 157 bits (397), Expect = 3e-36 Identities = 78/92 (84%), Positives = 83/92 (90%), Gaps = 1/92 (1%) Frame = +2 Query: 77 MSGTQEQDQDQDK-KHINLKVKGQDGNETFFRIKRSTQLKKLMNAYCDRQSVQFDSIAFL 253 MS T E+D+ D+ HINLKVKGQDGNE FFRIKRSTQLKKLMNAYCDRQSV F+SIAFL Sbjct: 1 MSATPEEDKKPDQGAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDFNSIAFL 60 Query: 254 FDGRRLRVEQTPEELEMEDGDEIDAMLHQTGG 349 FDGRRLR EQTP+ELEMEDGDEIDAMLHQTGG Sbjct: 61 FDGRRLRAEQTPDELEMEDGDEIDAMLHQTGG 92 >gb|EMJ13486.1| hypothetical protein PRUPE_ppa013880mg [Prunus persica] Length = 98 Score = 156 bits (394), Expect = 6e-36 Identities = 77/95 (81%), Positives = 83/95 (87%), Gaps = 4/95 (4%) Frame = +2 Query: 77 MSGTQEQDQDQ----DKKHINLKVKGQDGNETFFRIKRSTQLKKLMNAYCDRQSVQFDSI 244 MSG Q++D+ HINLKVKGQDGNE FFRIKRSTQLKKLMNAYCDRQSV+F+SI Sbjct: 1 MSGVTNQEEDKKPTDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVEFNSI 60 Query: 245 AFLFDGRRLRVEQTPEELEMEDGDEIDAMLHQTGG 349 AFLFDGRRLR EQTP+ELEMEDGDEIDAMLHQTGG Sbjct: 61 AFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGG 95 >ref|XP_004150752.1| PREDICTED: small ubiquitin-related modifier 2-like [Cucumis sativus] gi|449505442|ref|XP_004162471.1| PREDICTED: small ubiquitin-related modifier 2-like [Cucumis sativus] Length = 100 Score = 156 bits (394), Expect = 6e-36 Identities = 78/98 (79%), Positives = 83/98 (84%), Gaps = 6/98 (6%) Frame = +2 Query: 77 MSGTQEQDQDQDKK------HINLKVKGQDGNETFFRIKRSTQLKKLMNAYCDRQSVQFD 238 MSG Q++DKK HINLKVKGQDGNE FFRIKRSTQLKKLMNAYCDRQSV + Sbjct: 1 MSGVTNTQQEEDKKPNDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDLN 60 Query: 239 SIAFLFDGRRLRVEQTPEELEMEDGDEIDAMLHQTGGT 352 SIAFLFDGRRLR EQTP+ELEMEDGDEIDAMLHQTGG+ Sbjct: 61 SIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGS 98 >ref|XP_002529470.1| conserved hypothetical protein [Ricinus communis] gi|223531086|gb|EEF32936.1| conserved hypothetical protein [Ricinus communis] Length = 99 Score = 155 bits (393), Expect = 8e-36 Identities = 78/96 (81%), Positives = 83/96 (86%), Gaps = 5/96 (5%) Frame = +2 Query: 77 MSGTQEQDQD-----QDKKHINLKVKGQDGNETFFRIKRSTQLKKLMNAYCDRQSVQFDS 241 MSG Q++D Q HINLKVKGQDGNE FFRIKRSTQLKKLMNAYCDRQSV+F+S Sbjct: 1 MSGVTNQEEDKKPTDQSAAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVEFNS 60 Query: 242 IAFLFDGRRLRVEQTPEELEMEDGDEIDAMLHQTGG 349 IAFLFDGRRLR EQTP+ELEMEDGDEIDAMLHQTGG Sbjct: 61 IAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGG 96 >ref|XP_006447642.1| hypothetical protein CICLE_v10017283mg [Citrus clementina] gi|568830674|ref|XP_006469615.1| PREDICTED: small ubiquitin-related modifier 1-like [Citrus sinensis] gi|557550253|gb|ESR60882.1| hypothetical protein CICLE_v10017283mg [Citrus clementina] Length = 101 Score = 155 bits (391), Expect = 1e-35 Identities = 78/97 (80%), Positives = 83/97 (85%), Gaps = 6/97 (6%) Frame = +2 Query: 77 MSGTQEQDQDQDKK------HINLKVKGQDGNETFFRIKRSTQLKKLMNAYCDRQSVQFD 238 MSG Q++DKK HINLKVKGQDGNE FFRIKRSTQLKKLMNAYCDRQSV+ + Sbjct: 1 MSGVTNTPQEEDKKPNDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELN 60 Query: 239 SIAFLFDGRRLRVEQTPEELEMEDGDEIDAMLHQTGG 349 SIAFLFDGRRLR EQTP+ELEMEDGDEIDAMLHQTGG Sbjct: 61 SIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGG 97 >gb|ABN05665.1| ubiquitin-like protein [Pisum sativum] Length = 94 Score = 155 bits (391), Expect = 1e-35 Identities = 75/90 (83%), Positives = 80/90 (88%) Frame = +2 Query: 83 GTQEQDQDQDKKHINLKVKGQDGNETFFRIKRSTQLKKLMNAYCDRQSVQFDSIAFLFDG 262 G ++ DQ HINLKVKGQDGNE FFRIKRSTQLKKLMNAYCDRQSV F+SIAFLFDG Sbjct: 3 GEDKKPTDQGGAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDFNSIAFLFDG 62 Query: 263 RRLRVEQTPEELEMEDGDEIDAMLHQTGGT 352 RRLR EQTP+ELEMEDGDEIDAMLHQTGG+ Sbjct: 63 RRLRAEQTPDELEMEDGDEIDAMLHQTGGS 92 >ref|XP_004149348.1| PREDICTED: small ubiquitin-related modifier 2-like [Cucumis sativus] gi|449503205|ref|XP_004161886.1| PREDICTED: small ubiquitin-related modifier 2-like [Cucumis sativus] Length = 100 Score = 154 bits (389), Expect = 2e-35 Identities = 77/95 (81%), Positives = 81/95 (85%), Gaps = 4/95 (4%) Frame = +2 Query: 77 MSGTQEQDQDQ----DKKHINLKVKGQDGNETFFRIKRSTQLKKLMNAYCDRQSVQFDSI 244 MSG Q++D+ HINLKVKGQDGNE FFRIKRSTQLKKLMNAYCDRQSV +SI Sbjct: 1 MSGVTNQEEDKKPTDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDLNSI 60 Query: 245 AFLFDGRRLRVEQTPEELEMEDGDEIDAMLHQTGG 349 AFLFDGRRLR EQTPEELEMEDGDEIDAMLHQTGG Sbjct: 61 AFLFDGRRLRAEQTPEELEMEDGDEIDAMLHQTGG 95 >ref|XP_004513888.1| PREDICTED: small ubiquitin-related modifier 1-like [Cicer arietinum] Length = 100 Score = 153 bits (386), Expect = 5e-35 Identities = 74/83 (89%), Positives = 77/83 (92%) Frame = +2 Query: 104 DQDKKHINLKVKGQDGNETFFRIKRSTQLKKLMNAYCDRQSVQFDSIAFLFDGRRLRVEQ 283 DQ HINLKVKGQDGNE FFRIKRSTQLKKLMNAYCDRQSV F+SIAFLFDGRRLR EQ Sbjct: 16 DQGGAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDFNSIAFLFDGRRLRAEQ 75 Query: 284 TPEELEMEDGDEIDAMLHQTGGT 352 TP+ELEMEDGDEIDAMLHQTGG+ Sbjct: 76 TPDELEMEDGDEIDAMLHQTGGS 98 >gb|AFK36023.1| unknown [Lotus japonicus] Length = 102 Score = 153 bits (386), Expect = 5e-35 Identities = 75/92 (81%), Positives = 80/92 (86%) Frame = +2 Query: 74 TMSGTQEQDQDQDKKHINLKVKGQDGNETFFRIKRSTQLKKLMNAYCDRQSVQFDSIAFL 253 T + ++ DQ HINLKVKGQDGNE FFRIKRSTQLKKLMNAYCDRQSV F+SIAFL Sbjct: 8 TNNEEDKKPTDQGGAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDFNSIAFL 67 Query: 254 FDGRRLRVEQTPEELEMEDGDEIDAMLHQTGG 349 FDGRRLR EQTP+ELEMEDGDEIDAMLHQTGG Sbjct: 68 FDGRRLRAEQTPDELEMEDGDEIDAMLHQTGG 99 >ref|XP_003552121.1| PREDICTED: small ubiquitin-related modifier 2-like [Glycine max] Length = 114 Score = 152 bits (385), Expect = 7e-35 Identities = 75/91 (82%), Positives = 82/91 (90%), Gaps = 2/91 (2%) Frame = +2 Query: 83 GTQEQDQDQDKK--HINLKVKGQDGNETFFRIKRSTQLKKLMNAYCDRQSVQFDSIAFLF 256 G+QE+++ + HINLKVKGQDGNE FFRIKRSTQLKKLMNAYCDRQSV F+SIAFLF Sbjct: 8 GSQEEEKKPSDQGAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDFNSIAFLF 67 Query: 257 DGRRLRVEQTPEELEMEDGDEIDAMLHQTGG 349 DGRRLR EQTP+ELEMEDGDEIDAMLHQTGG Sbjct: 68 DGRRLRAEQTPDELEMEDGDEIDAMLHQTGG 98 >ref|NP_001235208.1| uncharacterized protein LOC100500241 [Glycine max] gi|255629810|gb|ACU15255.1| unknown [Glycine max] Length = 99 Score = 152 bits (385), Expect = 7e-35 Identities = 76/97 (78%), Positives = 82/97 (84%), Gaps = 5/97 (5%) Frame = +2 Query: 77 MSGTQEQDQDQDKK-----HINLKVKGQDGNETFFRIKRSTQLKKLMNAYCDRQSVQFDS 241 MSG +++ K HINLKVKGQDGNE FFRIKRSTQLKKLMNAYCDRQSV F+S Sbjct: 1 MSGVTNNNEEDKKPTEQGAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDFNS 60 Query: 242 IAFLFDGRRLRVEQTPEELEMEDGDEIDAMLHQTGGT 352 IAFLFDGRRLR EQTP+ELEMEDGDEIDAMLHQTGG+ Sbjct: 61 IAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGS 97