BLASTX nr result
ID: Achyranthes23_contig00008218
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00008218 (725 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC27874.1| Cadmium/zinc-transporting ATPase 3 [Morus notabilis] 64 5e-08 gb|EMJ14910.1| hypothetical protein PRUPE_ppa000656mg [Prunus pe... 58 4e-06 >gb|EXC27874.1| Cadmium/zinc-transporting ATPase 3 [Morus notabilis] Length = 572 Score = 63.9 bits (154), Expect = 5e-08 Identities = 25/38 (65%), Positives = 30/38 (78%) Frame = +3 Query: 216 CSSLRKREIGACCKSYRKECCSAQGHIGPAFGGLTEIV 329 C L KRE+G CC+SY KECCS GH+G AFGGL+E+V Sbjct: 533 CMGLEKREMGGCCRSYMKECCSKHGHLGVAFGGLSEVV 570 >gb|EMJ14910.1| hypothetical protein PRUPE_ppa000656mg [Prunus persica] Length = 1050 Score = 57.8 bits (138), Expect = 4e-06 Identities = 25/37 (67%), Positives = 28/37 (75%), Gaps = 1/37 (2%) Frame = +3 Query: 225 LRKREIGACCKSYRKECCSAQGHIGPAFGG-LTEIVT 332 L KRE+G CCKSY KECC GHIGP+F G L+EI T Sbjct: 1011 LEKREVGGCCKSYMKECCGGHGHIGPSFKGCLSEITT 1047