BLASTX nr result
ID: Achyranthes23_contig00007882
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00007882 (218 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAH57023.1| AT5G01010 [Arabidopsis thaliana] 46 2e-06 gb|EXC35202.1| hypothetical protein L484_022756 [Morus notabilis] 50 4e-06 >dbj|BAH57023.1| AT5G01010 [Arabidopsis thaliana] Length = 448 Score = 46.2 bits (108), Expect(2) = 2e-06 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 126 LTFMTQLMLPYRRCESDQGNFCTCLAGTYKL 218 + F T L+LPYRR E+DQGNF T +AG YKL Sbjct: 383 INFQTLLILPYRRYEADQGNFSTLMAGNYKL 413 Score = 31.2 bits (69), Expect(2) = 2e-06 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +1 Query: 1 GFSVEYMDSSGEKVVSCQPNF 63 GFSVEY+++SGEK VS NF Sbjct: 365 GFSVEYINASGEKTVSLLINF 385 >gb|EXC35202.1| hypothetical protein L484_022756 [Morus notabilis] Length = 503 Score = 49.7 bits (117), Expect(2) = 4e-06 Identities = 20/25 (80%), Positives = 23/25 (92%) Frame = +3 Query: 144 LMLPYRRCESDQGNFCTCLAGTYKL 218 L+LPYRR E+DQGNFCTC+AG YKL Sbjct: 443 LILPYRRYEADQGNFCTCMAGNYKL 467 Score = 26.6 bits (57), Expect(2) = 4e-06 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = +1 Query: 1 GFSVEYMDSSGEKVV 45 GFSVEY +SSGEK + Sbjct: 429 GFSVEYTNSSGEKTL 443