BLASTX nr result
ID: Achyranthes23_contig00007807
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00007807 (574 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006842617.1| hypothetical protein AMTR_s00077p00178230 [A... 58 2e-06 ref|XP_006422078.1| hypothetical protein CICLE_v10005564mg [Citr... 56 8e-06 >ref|XP_006842617.1| hypothetical protein AMTR_s00077p00178230 [Amborella trichopoda] gi|548844703|gb|ERN04292.1| hypothetical protein AMTR_s00077p00178230 [Amborella trichopoda] Length = 257 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -2 Query: 99 LFRTDFVLLHTVPVLYEKHEDKVDAFAERAIGE 1 LF FV+LHTVPVLYEKHEDKVD FAERA+GE Sbjct: 198 LFYIVFVILHTVPVLYEKHEDKVDFFAERALGE 230 >ref|XP_006422078.1| hypothetical protein CICLE_v10005564mg [Citrus clementina] gi|557523951|gb|ESR35318.1| hypothetical protein CICLE_v10005564mg [Citrus clementina] Length = 287 Score = 55.8 bits (133), Expect = 8e-06 Identities = 25/40 (62%), Positives = 32/40 (80%) Frame = -2 Query: 129 LIKVMDLTIFLFRTDFVLLHTVPVLYEKHEDKVDAFAERA 10 L+K +DL F T FVLLHTVPV+YEK+EDK+D+F E+A Sbjct: 216 LLKCLDLLYGSFETVFVLLHTVPVIYEKYEDKIDSFGEKA 255