BLASTX nr result
ID: Achyranthes23_contig00007650
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00007650 (289 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002276443.1| PREDICTED: uncharacterized protein LOC100245... 55 9e-06 emb|CAN65744.1| hypothetical protein VITISV_037761 [Vitis vinifera] 55 9e-06 >ref|XP_002276443.1| PREDICTED: uncharacterized protein LOC100245891 [Vitis vinifera] Length = 314 Score = 55.1 bits (131), Expect = 9e-06 Identities = 24/46 (52%), Positives = 30/46 (65%) Frame = -2 Query: 147 CNSDDHWILHNHVEYRTTQPRKLCTSCFLKLYPASFCPTCLNLHDP 10 C+ D W+LH HV +R R+LCTSC LKL+P FCP C +DP Sbjct: 13 CSLTDRWLLH-HVRHRGIY-RRLCTSCVLKLHPGLFCPICFEFYDP 56 >emb|CAN65744.1| hypothetical protein VITISV_037761 [Vitis vinifera] Length = 1076 Score = 55.1 bits (131), Expect = 9e-06 Identities = 24/46 (52%), Positives = 30/46 (65%) Frame = -2 Query: 147 CNSDDHWILHNHVEYRTTQPRKLCTSCFLKLYPASFCPTCLNLHDP 10 C+ D W+LH HV +R R+LCTSC LKL+P FCP C +DP Sbjct: 775 CSLTDRWLLH-HVRHRGIY-RRLCTSCVLKLHPGLFCPICFEFYDP 818