BLASTX nr result
ID: Achyranthes23_contig00007544
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00007544 (1125 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006854835.1| hypothetical protein AMTR_s00063p00208440 [A... 72 2e-23 gb|AGC81699.1| hypothetical protein DCGMS_00390 (mitochondrion) ... 87 3e-16 ref|XP_002534949.1| conserved hypothetical protein [Ricinus comm... 79 5e-14 ref|XP_006854832.1| hypothetical protein AMTR_s00063p00206020 [A... 80 1e-12 ref|XP_006842415.1| hypothetical protein AMTR_s05659p00002430 [A... 66 4e-11 ref|XP_006842414.1| hypothetical protein AMTR_s05659p00000220 [A... 74 1e-10 ref|XP_002527161.1| cytochrome C oxidase, subunit II, putative [... 61 5e-10 emb|CBI36501.3| unnamed protein product [Vitis vinifera] 70 1e-09 ref|XP_002534948.1| conserved hypothetical protein [Ricinus comm... 69 5e-09 >ref|XP_006854835.1| hypothetical protein AMTR_s00063p00208440 [Amborella trichopoda] gi|548858539|gb|ERN16302.1| hypothetical protein AMTR_s00063p00208440 [Amborella trichopoda] Length = 107 Score = 71.6 bits (174), Expect(2) = 2e-23 Identities = 36/54 (66%), Positives = 37/54 (68%) Frame = -3 Query: 283 LLWYGVPRGFSSASRREECHQLGRYWPLTTXXXXXXXXRFKFVILTVFSASPGA 122 L YGVP GFSSAS R ECHQLGRYWPLTT RF FV+L V SA PGA Sbjct: 54 LALYGVPHGFSSASHRGECHQLGRYWPLTTRSPAARAPRFNFVMLIVSSAPPGA 107 Score = 65.9 bits (159), Expect(2) = 2e-23 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -2 Query: 401 DTVACPWGRGSPDFHRSLVRSPNENGGPCAGVSSL 297 DT+A PWGRGSPDFHRSLVR PNEN GPC G+ SL Sbjct: 18 DTIALPWGRGSPDFHRSLVRPPNENLGPCTGLLSL 52 >gb|AGC81699.1| hypothetical protein DCGMS_00390 (mitochondrion) [Raphanus sativus] Length = 92 Score = 87.0 bits (214), Expect(2) = 3e-16 Identities = 47/67 (70%), Positives = 48/67 (71%) Frame = -2 Query: 230 MPSTRALLATNHSPAGRSGSAFQVRYPNRLLCFTGSLAPFSIXXXXXXXXXXXLQPFAVK 51 MPSTRALLATNHS A RSGSAFQVRYPNR LC TG LAP SI LQP AV Sbjct: 1 MPSTRALLATNHSLASRSGSAFQVRYPNRPLCSTGCLAPSSILSTALLLGSLQLQPLAVI 60 Query: 50 ACFSGGA 30 ACFSGG+ Sbjct: 61 ACFSGGS 67 Score = 25.8 bits (55), Expect(2) = 3e-16 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -3 Query: 40 RVVRLSQSGLSSR 2 RVVRLSQSGL+SR Sbjct: 70 RVVRLSQSGLNSR 82 >ref|XP_002534949.1| conserved hypothetical protein [Ricinus communis] gi|223524315|gb|EEF27434.1| conserved hypothetical protein [Ricinus communis] Length = 90 Score = 79.0 bits (193), Expect(2) = 5e-14 Identities = 43/59 (72%), Positives = 43/59 (72%) Frame = -2 Query: 230 MPSTRALLATNHSPAGRSGSAFQVRYPNRLLCFTGSLAPFSIXXXXXXXXXXXLQPFAV 54 MPSTRALLATNHS AGR GSAFQVRYPNRLLC TGSLAP SI LQP AV Sbjct: 1 MPSTRALLATNHSLAGRLGSAFQVRYPNRLLCSTGSLAPSSILSTALLLGSLQLQPLAV 59 Score = 26.6 bits (57), Expect(2) = 5e-14 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = -3 Query: 49 LAFRVVRLSQSGLSSR 2 LA VVRLSQSGLSSR Sbjct: 65 LAPEVVRLSQSGLSSR 80 >ref|XP_006854832.1| hypothetical protein AMTR_s00063p00206020 [Amborella trichopoda] gi|548858536|gb|ERN16299.1| hypothetical protein AMTR_s00063p00206020 [Amborella trichopoda] Length = 113 Score = 80.5 bits (197), Expect = 1e-12 Identities = 44/78 (56%), Positives = 48/78 (61%), Gaps = 2/78 (2%) Frame = -2 Query: 230 MPSTRALLATNHSPAGRSGSAFQVRYPNRLLCFTGSLAPFSIXXXXXXXXXXXLQ--PFA 57 MPSTRALLATNHS GRS S FQ+RYPNRLLC TGSL P S LQ Sbjct: 1 MPSTRALLATNHSLTGRSSSTFQLRYPNRLLCSTGSLTPSSTLSTTSLLSSLLLQLPALI 60 Query: 56 VKACFSGGAAEPEWAQQS 3 ++ GGA EP+WAQ S Sbjct: 61 ARSFLGGGAIEPQWAQHS 78 >ref|XP_006842415.1| hypothetical protein AMTR_s05659p00002430 [Amborella trichopoda] gi|548844498|gb|ERN04090.1| hypothetical protein AMTR_s05659p00002430 [Amborella trichopoda] Length = 115 Score = 66.2 bits (160), Expect(2) = 4e-11 Identities = 30/40 (75%), Positives = 38/40 (95%) Frame = +1 Query: 34 PPEKQAFTANGWSSREPRSKAVNKIEKGARLPVKQRRRLG 153 P +++A TA+GWSSREPRS+AV+KIE+GARLPV+QRRRLG Sbjct: 76 PKKERAITASGWSSREPRSEAVDKIEEGARLPVEQRRRLG 115 Score = 29.6 bits (65), Expect(2) = 4e-11 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +3 Query: 3 RLLSPLWLSRTTRK 44 RLLSPLWLSRTT K Sbjct: 64 RLLSPLWLSRTTPK 77 >ref|XP_006842414.1| hypothetical protein AMTR_s05659p00000220 [Amborella trichopoda] gi|548844497|gb|ERN04089.1| hypothetical protein AMTR_s05659p00000220 [Amborella trichopoda] Length = 102 Score = 73.6 bits (179), Expect = 1e-10 Identities = 44/74 (59%), Positives = 49/74 (66%), Gaps = 1/74 (1%) Frame = +3 Query: 357 MEVGATPSPRTRNSVLREEFRGLIVARTSFSF*IMRRGPVQDRTLPLQREQTLS-TARRH 533 MEVGATPSP RNSVLREEFRGLIVARTSF + + +++ S RRH Sbjct: 1 MEVGATPSPWQRNSVLREEFRGLIVARTSFFLGHAKGASPRSYCSSTKKDNRRSQRRRRH 60 Query: 534 SLSE*F*LLHDFVP 575 SLSE F LLHDFVP Sbjct: 61 SLSEFFQLLHDFVP 74 >ref|XP_002527161.1| cytochrome C oxidase, subunit II, putative [Ricinus communis] gi|223533482|gb|EEF35227.1| cytochrome C oxidase, subunit II, putative [Ricinus communis] Length = 139 Score = 61.2 bits (147), Expect(2) = 5e-10 Identities = 29/46 (63%), Positives = 36/46 (78%) Frame = +1 Query: 16 HSGSAAPPEKQAFTANGWSSREPRSKAVNKIEKGARLPVKQRRRLG 153 H PP+KQ TA+ WS REPRSKAV+KI++GARL V+QRR+LG Sbjct: 94 HHPGCDPPKKQDITASDWSCREPRSKAVDKIKEGARLLVEQRRQLG 139 Score = 30.8 bits (68), Expect(2) = 5e-10 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +2 Query: 2 PTAEPTLAQPHHP 40 PTAE TLAQPHHP Sbjct: 84 PTAESTLAQPHHP 96 >emb|CBI36501.3| unnamed protein product [Vitis vinifera] Length = 274 Score = 70.5 bits (171), Expect = 1e-09 Identities = 41/64 (64%), Positives = 45/64 (70%), Gaps = 5/64 (7%) Frame = +3 Query: 756 PSFRWFSSRTLYRLEL----F*LKKGERFGTK-LLAFSLPRGEGSLTYRFQAWREAKGLD 920 PS + LYRLEL L+KGER + LLAFSLP+GEGSLTY FQAWRE KGLD Sbjct: 205 PSLPLVLACPLYRLELCLTPLLLEKGERVIFRGLLAFSLPKGEGSLTYGFQAWREVKGLD 264 Query: 921 FTYD 932 FTYD Sbjct: 265 FTYD 268 >ref|XP_002534948.1| conserved hypothetical protein [Ricinus communis] gi|223524314|gb|EEF27433.1| conserved hypothetical protein [Ricinus communis] Length = 114 Score = 68.6 bits (166), Expect = 5e-09 Identities = 33/48 (68%), Positives = 38/48 (79%) Frame = +3 Query: 789 YRLELF*LKKGERFGTKLLAFSLPRGEGSLTYRFQAWREAKGLDFTYD 932 Y L +K+ + F + LLAFSLPRGEGSLTY FQAWR+AKGLDFTYD Sbjct: 61 YEAYLIIMKRRKGFFSLLLAFSLPRGEGSLTYGFQAWRKAKGLDFTYD 108