BLASTX nr result
ID: Achyranthes23_contig00006632
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00006632 (294 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACV52592.1| thioredoxin H-type 1, partial [Nicotiana benthami... 66 4e-09 gb|EMJ03965.1| hypothetical protein PRUPE_ppa013476mg [Prunus pe... 65 7e-09 sp|O65049.1|TRXH_PICMA RecName: Full=Thioredoxin H-type; Short=T... 65 1e-08 gb|ABK20906.1| unknown [Picea sitchensis] gi|116789762|gb|ABK253... 65 1e-08 gb|AFP49340.1| thioredoxin h [Olea europaea] 64 2e-08 gb|ABD65296.1| thioredoxin [Solanum berthaultii] 64 2e-08 pdb|1TI3|A Chain A, Solution Structure Of The Thioredoxin H1 Fro... 64 2e-08 gb|AEC03316.1| thioredoxin H-type 2 [Hevea brasiliensis] 64 2e-08 ref|XP_002310830.2| thioredoxin h family protein [Populus tricho... 64 2e-08 ref|XP_002307687.1| thioredoxin h family protein [Populus tricho... 64 2e-08 sp|P29449.1|TRXH1_TOBAC RecName: Full=Thioredoxin H-type 1; Shor... 64 3e-08 ref|XP_004287851.1| PREDICTED: thioredoxin H-type-like [Fragaria... 63 5e-08 sp|Q07090.1|TRXH2_TOBAC RecName: Full=Thioredoxin H-type 2; Shor... 63 5e-08 ref|XP_004291829.1| PREDICTED: thioredoxin H-type-like [Fragaria... 62 6e-08 ref|XP_004238306.1| PREDICTED: thioredoxin H-type 1-like [Solanu... 62 6e-08 gb|ADN96593.1| thioredoxin h [Vitis vinifera] 62 6e-08 emb|CBI17430.3| unnamed protein product [Vitis vinifera] 62 6e-08 ref|XP_002510456.1| Thioredoxin H-type, putative [Ricinus commun... 62 6e-08 gb|ABK24945.1| unknown [Picea sitchensis] gi|116790214|gb|ABK255... 62 6e-08 ref|XP_002274205.1| PREDICTED: thioredoxin H-type 2 [Vitis vinif... 62 6e-08 >gb|ACV52592.1| thioredoxin H-type 1, partial [Nicotiana benthamiana] Length = 119 Score = 66.2 bits (160), Expect = 4e-09 Identities = 33/52 (63%), Positives = 43/52 (82%) Frame = -2 Query: 293 IDVDELKSVAQDLSVEAMPTFIFLKDGKEIEKSRIVGADKDKLADRIAKLAA 138 +DVDELK+VA++ SVEAMPTF+FLKDGKE++ R+VGA K++L I K AA Sbjct: 64 VDVDELKTVAEEWSVEAMPTFVFLKDGKEVD--RVVGAKKEELQQTILKHAA 113 >gb|EMJ03965.1| hypothetical protein PRUPE_ppa013476mg [Prunus persica] Length = 120 Score = 65.5 bits (158), Expect = 7e-09 Identities = 34/52 (65%), Positives = 42/52 (80%) Frame = -2 Query: 293 IDVDELKSVAQDLSVEAMPTFIFLKDGKEIEKSRIVGADKDKLADRIAKLAA 138 +DVDELKSVAQD +VEAMPTF+FLK+GK ++K +VGA KD+L IAK A Sbjct: 65 VDVDELKSVAQDWAVEAMPTFMFLKEGKIVDK--VVGAKKDELQQTIAKHVA 114 >sp|O65049.1|TRXH_PICMA RecName: Full=Thioredoxin H-type; Short=Trx-H gi|2982247|gb|AAC32111.1| probable thioredoxin H [Picea mariana] Length = 125 Score = 64.7 bits (156), Expect = 1e-08 Identities = 32/52 (61%), Positives = 41/52 (78%) Frame = -2 Query: 293 IDVDELKSVAQDLSVEAMPTFIFLKDGKEIEKSRIVGADKDKLADRIAKLAA 138 +DVDEL+ VAQ+ VEAMPTFIF+KDGK ++K +VGA KD L ++A LAA Sbjct: 63 VDVDELRDVAQEWDVEAMPTFIFIKDGKAVDK--VVGAKKDDLERKVAALAA 112 >gb|ABK20906.1| unknown [Picea sitchensis] gi|116789762|gb|ABK25373.1| unknown [Picea sitchensis] gi|224286778|gb|ACN41092.1| unknown [Picea sitchensis] Length = 125 Score = 64.7 bits (156), Expect = 1e-08 Identities = 32/52 (61%), Positives = 41/52 (78%) Frame = -2 Query: 293 IDVDELKSVAQDLSVEAMPTFIFLKDGKEIEKSRIVGADKDKLADRIAKLAA 138 +DVDEL+ VAQ+ VEAMPTFIF+KDGK ++K +VGA KD L ++A LAA Sbjct: 63 VDVDELRDVAQEWDVEAMPTFIFIKDGKAVDK--VVGAKKDDLERKVAALAA 112 >gb|AFP49340.1| thioredoxin h [Olea europaea] Length = 123 Score = 64.3 bits (155), Expect = 2e-08 Identities = 32/51 (62%), Positives = 41/51 (80%) Frame = -2 Query: 293 IDVDELKSVAQDLSVEAMPTFIFLKDGKEIEKSRIVGADKDKLADRIAKLA 141 +DVDELK VA++ +VEAMPTF+FLKDGKE++ R+VGA K+ L D I K A Sbjct: 65 VDVDELKDVAKEFNVEAMPTFVFLKDGKEVD--RLVGARKENLQDTINKHA 113 >gb|ABD65296.1| thioredoxin [Solanum berthaultii] Length = 123 Score = 64.3 bits (155), Expect = 2e-08 Identities = 32/56 (57%), Positives = 42/56 (75%) Frame = -2 Query: 293 IDVDELKSVAQDLSVEAMPTFIFLKDGKEIEKSRIVGADKDKLADRIAKLAAGQPI 126 +DVDELK VA+D +VEAMPTF+F+K+GKE++ R+VGA+KD L I K A I Sbjct: 67 VDVDELKKVAEDWNVEAMPTFVFIKEGKEVD--RVVGANKDGLLQTIEKHGAAPAI 120 >pdb|1TI3|A Chain A, Solution Structure Of The Thioredoxin H1 From Poplar, A Cppc Active Site Variant Length = 113 Score = 63.9 bits (154), Expect = 2e-08 Identities = 33/51 (64%), Positives = 42/51 (82%) Frame = -2 Query: 293 IDVDELKSVAQDLSVEAMPTFIFLKDGKEIEKSRIVGADKDKLADRIAKLA 141 +DVDELK+VA++ +VEAMPTFIFLKDGK ++K+ VGADKD L +AK A Sbjct: 63 VDVDELKAVAEEWNVEAMPTFIFLKDGKLVDKT--VGADKDGLPTLVAKHA 111 >gb|AEC03316.1| thioredoxin H-type 2 [Hevea brasiliensis] Length = 118 Score = 63.9 bits (154), Expect = 2e-08 Identities = 32/49 (65%), Positives = 42/49 (85%) Frame = -2 Query: 293 IDVDELKSVAQDLSVEAMPTFIFLKDGKEIEKSRIVGADKDKLADRIAK 147 +DVDELK+VAQD +VEAMPTFIFL++G ++K +VGA+KDKL + IAK Sbjct: 65 VDVDELKTVAQDWAVEAMPTFIFLREGTILDK--VVGANKDKLHETIAK 111 >ref|XP_002310830.2| thioredoxin h family protein [Populus trichocarpa] gi|118481453|gb|ABK92669.1| unknown [Populus trichocarpa] gi|550334812|gb|EEE91280.2| thioredoxin h family protein [Populus trichocarpa] Length = 122 Score = 63.9 bits (154), Expect = 2e-08 Identities = 33/52 (63%), Positives = 42/52 (80%) Frame = -2 Query: 293 IDVDELKSVAQDLSVEAMPTFIFLKDGKEIEKSRIVGADKDKLADRIAKLAA 138 +DVDELK+VAQD +VEAMPTF+FLK+GK ++K +VGA KD+L IAK A Sbjct: 65 VDVDELKTVAQDWAVEAMPTFMFLKEGKIVDK--VVGARKDELQQAIAKHTA 114 >ref|XP_002307687.1| thioredoxin h family protein [Populus trichocarpa] gi|19851972|gb|AAL99941.1| thioredoxin H [Populus tremula x Populus tremuloides] gi|118485155|gb|ABK94440.1| unknown [Populus trichocarpa] gi|222857136|gb|EEE94683.1| thioredoxin h family protein [Populus trichocarpa] Length = 114 Score = 63.9 bits (154), Expect = 2e-08 Identities = 33/51 (64%), Positives = 42/51 (82%) Frame = -2 Query: 293 IDVDELKSVAQDLSVEAMPTFIFLKDGKEIEKSRIVGADKDKLADRIAKLA 141 +DVDELK+VA++ +VEAMPTFIFLKDGK ++K+ VGADKD L +AK A Sbjct: 64 VDVDELKAVAEEWNVEAMPTFIFLKDGKLVDKT--VGADKDGLPTLVAKHA 112 >sp|P29449.1|TRXH1_TOBAC RecName: Full=Thioredoxin H-type 1; Short=Trx-H1 gi|20047|emb|CAA41415.1| thioredoxin [Nicotiana tabacum] Length = 126 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/52 (59%), Positives = 42/52 (80%) Frame = -2 Query: 293 IDVDELKSVAQDLSVEAMPTFIFLKDGKEIEKSRIVGADKDKLADRIAKLAA 138 +DVDELK+V+ + SVEAMPTF+F+KDGKE++ R+VGA K++L I K AA Sbjct: 71 VDVDELKTVSAEWSVEAMPTFVFIKDGKEVD--RVVGAKKEELQQTIVKHAA 120 >ref|XP_004287851.1| PREDICTED: thioredoxin H-type-like [Fragaria vesca subsp. vesca] Length = 118 Score = 62.8 bits (151), Expect = 5e-08 Identities = 32/52 (61%), Positives = 42/52 (80%) Frame = -2 Query: 293 IDVDELKSVAQDLSVEAMPTFIFLKDGKEIEKSRIVGADKDKLADRIAKLAA 138 IDVDELKSVA+D +VEAMPTF+FLK+GK ++K +VGA K++L +AK A Sbjct: 65 IDVDELKSVAEDWAVEAMPTFMFLKEGKIVDK--VVGAKKEELQQTVAKHVA 114 >sp|Q07090.1|TRXH2_TOBAC RecName: Full=Thioredoxin H-type 2; Short=Trx-H2 gi|297519|emb|CAA77847.1| THIOREDOXIN [Nicotiana tabacum] gi|447151|prf||1913431A thioredoxin Length = 118 Score = 62.8 bits (151), Expect = 5e-08 Identities = 32/49 (65%), Positives = 40/49 (81%) Frame = -2 Query: 293 IDVDELKSVAQDLSVEAMPTFIFLKDGKEIEKSRIVGADKDKLADRIAK 147 +DVDELKSVA D +VEAMPTF+FLK+GK ++K +VGA KD+L IAK Sbjct: 64 VDVDELKSVATDWAVEAMPTFMFLKEGKIVDK--VVGAKKDELQQTIAK 110 >ref|XP_004291829.1| PREDICTED: thioredoxin H-type-like [Fragaria vesca subsp. vesca] Length = 122 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/52 (57%), Positives = 42/52 (80%) Frame = -2 Query: 293 IDVDELKSVAQDLSVEAMPTFIFLKDGKEIEKSRIVGADKDKLADRIAKLAA 138 +DVDELK VA+D +VEAMPTF+FLK+GK ++K +VGA KD+L ++ + AA Sbjct: 65 VDVDELKKVAEDWAVEAMPTFMFLKEGKIVDK--VVGAKKDELVQKVGQHAA 114 >ref|XP_004238306.1| PREDICTED: thioredoxin H-type 1-like [Solanum lycopersicum] Length = 123 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/56 (53%), Positives = 42/56 (75%) Frame = -2 Query: 293 IDVDELKSVAQDLSVEAMPTFIFLKDGKEIEKSRIVGADKDKLADRIAKLAAGQPI 126 +DVDELK VA++ +VEAMPTF+F+K+GKE++ R+VGA+KD L I K A + Sbjct: 67 VDVDELKKVAEEWNVEAMPTFVFIKEGKEVD--RVVGANKDGLLQTIEKHGAAPAV 120 >gb|ADN96593.1| thioredoxin h [Vitis vinifera] Length = 115 Score = 62.4 bits (150), Expect = 6e-08 Identities = 32/49 (65%), Positives = 39/49 (79%) Frame = -2 Query: 293 IDVDELKSVAQDLSVEAMPTFIFLKDGKEIEKSRIVGADKDKLADRIAK 147 +DVDELKSVA D +VEAMPTF+FLK GK ++K +VGA+KD L IAK Sbjct: 64 VDVDELKSVATDWAVEAMPTFMFLKQGKIVDK--VVGANKDSLQQTIAK 110 >emb|CBI17430.3| unnamed protein product [Vitis vinifera] Length = 152 Score = 62.4 bits (150), Expect = 6e-08 Identities = 32/49 (65%), Positives = 39/49 (79%) Frame = -2 Query: 293 IDVDELKSVAQDLSVEAMPTFIFLKDGKEIEKSRIVGADKDKLADRIAK 147 +DVDELKSVA D +VEAMPTF+FLK GK ++K +VGA+KD L IAK Sbjct: 101 VDVDELKSVATDWAVEAMPTFMFLKQGKIVDK--VVGANKDSLQQTIAK 147 >ref|XP_002510456.1| Thioredoxin H-type, putative [Ricinus communis] gi|223551157|gb|EEF52643.1| Thioredoxin H-type, putative [Ricinus communis] Length = 118 Score = 62.4 bits (150), Expect = 6e-08 Identities = 32/51 (62%), Positives = 42/51 (82%) Frame = -2 Query: 293 IDVDELKSVAQDLSVEAMPTFIFLKDGKEIEKSRIVGADKDKLADRIAKLA 141 +DVDELKSVA+D +VEAMPTF+FLK+GK + K +VGA+K++L IAK A Sbjct: 64 VDVDELKSVAEDWAVEAMPTFMFLKEGKIVHK--VVGANKEELQMTIAKYA 112 >gb|ABK24945.1| unknown [Picea sitchensis] gi|116790214|gb|ABK25545.1| unknown [Picea sitchensis] Length = 123 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/52 (57%), Positives = 41/52 (78%) Frame = -2 Query: 293 IDVDELKSVAQDLSVEAMPTFIFLKDGKEIEKSRIVGADKDKLADRIAKLAA 138 +DVDEL+ VAQ+ VEAMPTFIF++DG+ ++K +VGA KD L ++A LAA Sbjct: 63 VDVDELRDVAQEWDVEAMPTFIFIRDGRAVDK--VVGAKKDDLERKVAALAA 112 >ref|XP_002274205.1| PREDICTED: thioredoxin H-type 2 [Vitis vinifera] gi|452114364|gb|AGG09339.1| thioredoxin h1 [Vitis vinifera] Length = 115 Score = 62.4 bits (150), Expect = 6e-08 Identities = 32/49 (65%), Positives = 39/49 (79%) Frame = -2 Query: 293 IDVDELKSVAQDLSVEAMPTFIFLKDGKEIEKSRIVGADKDKLADRIAK 147 +DVDELKSVA D +VEAMPTF+FLK GK ++K +VGA+KD L IAK Sbjct: 64 VDVDELKSVATDWAVEAMPTFMFLKQGKIVDK--VVGANKDSLQQTIAK 110