BLASTX nr result
ID: Achyranthes23_contig00006155
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00006155 (490 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004152320.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 121 1e-25 ref|XP_006343509.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 117 1e-24 ref|XP_002297882.2| hypothetical protein POPTR_0001s12920g [Popu... 117 2e-24 gb|EPS63301.1| hypothetical protein M569_11486, partial [Genlise... 117 2e-24 gb|EMJ27219.1| hypothetical protein PRUPE_ppa010126mg [Prunus pe... 117 2e-24 dbj|BAD42981.1| unknown protein [Arabidopsis thaliana] 117 2e-24 ref|NP_196845.1| putative FKBP-type peptidyl-prolyl cis-trans is... 117 2e-24 ref|XP_006487561.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 116 3e-24 ref|XP_006420812.1| hypothetical protein CICLE_v10005642mg [Citr... 116 3e-24 ref|XP_006420808.1| hypothetical protein CICLE_v10005642mg [Citr... 116 3e-24 ref|XP_004491988.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 116 3e-24 ref|XP_001754815.1| predicted protein [Physcomitrella patens] gi... 116 3e-24 ref|XP_006601815.1| PREDICTED: uncharacterized protein LOC100797... 116 3e-24 ref|XP_002873610.1| immunophilin [Arabidopsis lyrata subsp. lyra... 116 3e-24 ref|NP_001241480.1| uncharacterized protein LOC100797411 [Glycin... 116 3e-24 ref|XP_006657427.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 115 5e-24 ref|XP_004975178.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 115 5e-24 ref|XP_004253232.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 115 5e-24 dbj|BAC82948.1| immunophilin/FKBP-type peptidyl-prolyl cis-trans... 115 5e-24 tpg|DAA48874.1| TPA: putative FKBP-like peptidyl-prolyl cis-tran... 115 5e-24 >ref|XP_004152320.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic-like [Cucumis sativus] gi|449522654|ref|XP_004168341.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic-like [Cucumis sativus] Length = 257 Score = 121 bits (303), Expect = 1e-25 Identities = 56/60 (93%), Positives = 60/60 (100%) Frame = +1 Query: 1 GGIRRIIVPPELGYPDNDYNQKGPRPTTFSGQRALSFVLRNQGLIDKTLLFDIELLKIVP 180 GG+RRIIVPPELGYPDNDYN+KGPRPTTFSGQRAL+FVLRNQGLIDKTLLFDIELLKI+P Sbjct: 194 GGVRRIIVPPELGYPDNDYNKKGPRPTTFSGQRALAFVLRNQGLIDKTLLFDIELLKIIP 253 >ref|XP_006343509.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic-like [Solanum tuberosum] Length = 335 Score = 117 bits (294), Expect = 1e-24 Identities = 56/60 (93%), Positives = 59/60 (98%) Frame = +1 Query: 1 GGIRRIIVPPELGYPDNDYNQKGPRPTTFSGQRALSFVLRNQGLIDKTLLFDIELLKIVP 180 GGIRRIIVPPELGYPD DY++KGPRPTTFSGQRALSFVLRNQGLIDKTLLFDIELLKI+P Sbjct: 275 GGIRRIIVPPELGYPDYDYDKKGPRPTTFSGQRALSFVLRNQGLIDKTLLFDIELLKIIP 334 >ref|XP_002297882.2| hypothetical protein POPTR_0001s12920g [Populus trichocarpa] gi|550347126|gb|EEE82687.2| hypothetical protein POPTR_0001s12920g [Populus trichocarpa] Length = 245 Score = 117 bits (293), Expect = 2e-24 Identities = 54/60 (90%), Positives = 58/60 (96%) Frame = +1 Query: 1 GGIRRIIVPPELGYPDNDYNQKGPRPTTFSGQRALSFVLRNQGLIDKTLLFDIELLKIVP 180 GGIRRIIVPPELGYP+NDYN+ GPRPTTFSGQRAL FVLRNQGLIDKTLLFDIELLK++P Sbjct: 185 GGIRRIIVPPELGYPENDYNKSGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKVIP 244 >gb|EPS63301.1| hypothetical protein M569_11486, partial [Genlisea aurea] Length = 196 Score = 117 bits (292), Expect = 2e-24 Identities = 54/60 (90%), Positives = 59/60 (98%) Frame = +1 Query: 1 GGIRRIIVPPELGYPDNDYNQKGPRPTTFSGQRALSFVLRNQGLIDKTLLFDIELLKIVP 180 GG+RRIIVPPELGYP+ND+N+KGPRPTTFSGQRAL FVLRNQGLIDKTLLFDIELLKI+P Sbjct: 133 GGVRRIIVPPELGYPENDFNKKGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKILP 192 >gb|EMJ27219.1| hypothetical protein PRUPE_ppa010126mg [Prunus persica] Length = 262 Score = 117 bits (292), Expect = 2e-24 Identities = 54/60 (90%), Positives = 58/60 (96%) Frame = +1 Query: 1 GGIRRIIVPPELGYPDNDYNQKGPRPTTFSGQRALSFVLRNQGLIDKTLLFDIELLKIVP 180 GGIRRIIVPPELGYP+NDYN+ GPRPTTFSGQRAL FVLRNQGLIDKTLLFDIEL+KI+P Sbjct: 202 GGIRRIIVPPELGYPENDYNKSGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELIKIIP 261 >dbj|BAD42981.1| unknown protein [Arabidopsis thaliana] Length = 255 Score = 117 bits (292), Expect = 2e-24 Identities = 55/60 (91%), Positives = 57/60 (95%) Frame = +1 Query: 1 GGIRRIIVPPELGYPDNDYNQKGPRPTTFSGQRALSFVLRNQGLIDKTLLFDIELLKIVP 180 GGIRRIIVPPELGYPDNDYN+ GPRP TFSGQRAL FVLRNQGLIDKTLLFD+ELLKIVP Sbjct: 195 GGIRRIIVPPELGYPDNDYNKSGPRPMTFSGQRALDFVLRNQGLIDKTLLFDVELLKIVP 254 >ref|NP_196845.1| putative FKBP-type peptidyl-prolyl cis-trans isomerase 7 [Arabidopsis thaliana] gi|75335665|sp|Q9LYR5.1|FKB19_ARATH RecName: Full=Peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic; Short=PPIase FKBP19; AltName: Full=FK506-binding protein 19; Short=AtFKBP19; AltName: Full=Immunophilin FKBP19; AltName: Full=Rotamase; Flags: Precursor gi|7543908|emb|CAB87148.1| putative protein [Arabidopsis thaliana] gi|46931302|gb|AAT06455.1| At5g13410 [Arabidopsis thaliana] gi|222423171|dbj|BAH19563.1| AT5G13410 [Arabidopsis thaliana] gi|332004508|gb|AED91891.1| putative FKBP-type peptidyl-prolyl cis-trans isomerase 7 [Arabidopsis thaliana] Length = 256 Score = 117 bits (292), Expect = 2e-24 Identities = 55/60 (91%), Positives = 57/60 (95%) Frame = +1 Query: 1 GGIRRIIVPPELGYPDNDYNQKGPRPTTFSGQRALSFVLRNQGLIDKTLLFDIELLKIVP 180 GGIRRIIVPPELGYPDNDYN+ GPRP TFSGQRAL FVLRNQGLIDKTLLFD+ELLKIVP Sbjct: 196 GGIRRIIVPPELGYPDNDYNKSGPRPMTFSGQRALDFVLRNQGLIDKTLLFDVELLKIVP 255 >ref|XP_006487561.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic-like isoform X1 [Citrus sinensis] Length = 267 Score = 116 bits (291), Expect = 3e-24 Identities = 53/60 (88%), Positives = 58/60 (96%) Frame = +1 Query: 1 GGIRRIIVPPELGYPDNDYNQKGPRPTTFSGQRALSFVLRNQGLIDKTLLFDIELLKIVP 180 GG+RRIIVPPE+GYP+NDYN+ GPRPTTFSGQRAL FVLRNQGLIDKTLLFDIELLKI+P Sbjct: 207 GGVRRIIVPPEIGYPENDYNKSGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIP 266 >ref|XP_006420812.1| hypothetical protein CICLE_v10005642mg [Citrus clementina] gi|557522685|gb|ESR34052.1| hypothetical protein CICLE_v10005642mg [Citrus clementina] Length = 250 Score = 116 bits (291), Expect = 3e-24 Identities = 53/60 (88%), Positives = 58/60 (96%) Frame = +1 Query: 1 GGIRRIIVPPELGYPDNDYNQKGPRPTTFSGQRALSFVLRNQGLIDKTLLFDIELLKIVP 180 GG+RRIIVPPE+GYP+NDYN+ GPRPTTFSGQRAL FVLRNQGLIDKTLLFDIELLKI+P Sbjct: 190 GGVRRIIVPPEIGYPENDYNKSGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIP 249 >ref|XP_006420808.1| hypothetical protein CICLE_v10005642mg [Citrus clementina] gi|567855379|ref|XP_006420809.1| hypothetical protein CICLE_v10005642mg [Citrus clementina] gi|557522681|gb|ESR34048.1| hypothetical protein CICLE_v10005642mg [Citrus clementina] gi|557522682|gb|ESR34049.1| hypothetical protein CICLE_v10005642mg [Citrus clementina] Length = 267 Score = 116 bits (291), Expect = 3e-24 Identities = 53/60 (88%), Positives = 58/60 (96%) Frame = +1 Query: 1 GGIRRIIVPPELGYPDNDYNQKGPRPTTFSGQRALSFVLRNQGLIDKTLLFDIELLKIVP 180 GG+RRIIVPPE+GYP+NDYN+ GPRPTTFSGQRAL FVLRNQGLIDKTLLFDIELLKI+P Sbjct: 207 GGVRRIIVPPEIGYPENDYNKSGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIP 266 >ref|XP_004491988.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic-like [Cicer arietinum] Length = 240 Score = 116 bits (291), Expect = 3e-24 Identities = 53/60 (88%), Positives = 58/60 (96%) Frame = +1 Query: 1 GGIRRIIVPPELGYPDNDYNQKGPRPTTFSGQRALSFVLRNQGLIDKTLLFDIELLKIVP 180 GG+RRIIVPPELGYP+NDYN+ GPRPTTFSGQRAL FVLRNQGLIDKTLLFDIEL+KI+P Sbjct: 180 GGVRRIIVPPELGYPENDYNKSGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELMKIIP 239 >ref|XP_001754815.1| predicted protein [Physcomitrella patens] gi|162693919|gb|EDQ80269.1| predicted protein [Physcomitrella patens] Length = 162 Score = 116 bits (291), Expect = 3e-24 Identities = 54/59 (91%), Positives = 58/59 (98%) Frame = +1 Query: 1 GGIRRIIVPPELGYPDNDYNQKGPRPTTFSGQRALSFVLRNQGLIDKTLLFDIELLKIV 177 GGIRR+IVPPELGYP+NDYNQKGPRPTTFSGQRAL FVLRNQGLIDKTLLFDIEL+K+V Sbjct: 103 GGIRRLIVPPELGYPNNDYNQKGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELIKVV 161 >ref|XP_006601815.1| PREDICTED: uncharacterized protein LOC100797411 isoform X1 [Glycine max] Length = 242 Score = 116 bits (290), Expect = 3e-24 Identities = 54/60 (90%), Positives = 58/60 (96%) Frame = +1 Query: 1 GGIRRIIVPPELGYPDNDYNQKGPRPTTFSGQRALSFVLRNQGLIDKTLLFDIELLKIVP 180 GGIRRIIVPPELGYP+ND+N+ GPRPTTFSGQRAL FVLRNQGLIDKTLLFDIELLKI+P Sbjct: 182 GGIRRIIVPPELGYPENDFNKSGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIP 241 >ref|XP_002873610.1| immunophilin [Arabidopsis lyrata subsp. lyrata] gi|297319447|gb|EFH49869.1| immunophilin [Arabidopsis lyrata subsp. lyrata] Length = 256 Score = 116 bits (290), Expect = 3e-24 Identities = 54/60 (90%), Positives = 57/60 (95%) Frame = +1 Query: 1 GGIRRIIVPPELGYPDNDYNQKGPRPTTFSGQRALSFVLRNQGLIDKTLLFDIELLKIVP 180 GGIRR+IVPPELGYPDNDYN+ GPRP TFSGQRAL FVLRNQGLIDKTLLFD+ELLKIVP Sbjct: 196 GGIRRLIVPPELGYPDNDYNKSGPRPMTFSGQRALDFVLRNQGLIDKTLLFDVELLKIVP 255 >ref|NP_001241480.1| uncharacterized protein LOC100797411 [Glycine max] gi|255646496|gb|ACU23726.1| unknown [Glycine max] Length = 241 Score = 116 bits (290), Expect = 3e-24 Identities = 54/60 (90%), Positives = 58/60 (96%) Frame = +1 Query: 1 GGIRRIIVPPELGYPDNDYNQKGPRPTTFSGQRALSFVLRNQGLIDKTLLFDIELLKIVP 180 GGIRRIIVPPELGYP+ND+N+ GPRPTTFSGQRAL FVLRNQGLIDKTLLFDIELLKI+P Sbjct: 181 GGIRRIIVPPELGYPENDFNKSGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIP 240 >ref|XP_006657427.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic-like [Oryza brachyantha] Length = 240 Score = 115 bits (289), Expect = 5e-24 Identities = 53/60 (88%), Positives = 58/60 (96%) Frame = +1 Query: 1 GGIRRIIVPPELGYPDNDYNQKGPRPTTFSGQRALSFVLRNQGLIDKTLLFDIELLKIVP 180 GG+RRIIVPP+LGYPDNDYN+ GP+PTTFSGQRAL FVLRNQGLIDKTLLFDIELLKI+P Sbjct: 179 GGVRRIIVPPDLGYPDNDYNKLGPKPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIP 238 >ref|XP_004975178.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic-like [Setaria italica] Length = 214 Score = 115 bits (289), Expect = 5e-24 Identities = 53/60 (88%), Positives = 58/60 (96%) Frame = +1 Query: 1 GGIRRIIVPPELGYPDNDYNQKGPRPTTFSGQRALSFVLRNQGLIDKTLLFDIELLKIVP 180 GG+RRIIVPP+LGYPDNDYN+ GP+PTTFSGQRAL FVLRNQGLIDKTLLFDIELLKI+P Sbjct: 153 GGVRRIIVPPDLGYPDNDYNKLGPKPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIP 212 >ref|XP_004253232.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic-like [Solanum lycopersicum] Length = 247 Score = 115 bits (289), Expect = 5e-24 Identities = 55/60 (91%), Positives = 59/60 (98%) Frame = +1 Query: 1 GGIRRIIVPPELGYPDNDYNQKGPRPTTFSGQRALSFVLRNQGLIDKTLLFDIELLKIVP 180 GGIRRIIVPPELGYP+ DY++KGPRPTTFSGQRALSFVLRNQGLIDKTLLFDIELLKI+P Sbjct: 187 GGIRRIIVPPELGYPNYDYDKKGPRPTTFSGQRALSFVLRNQGLIDKTLLFDIELLKIIP 246 >dbj|BAC82948.1| immunophilin/FKBP-type peptidyl-prolyl cis-trans isomerase-like protein [Oryza sativa Japonica Group] gi|50509301|dbj|BAD30608.1| immunophilin/FKBP-type peptidyl-prolyl cis-trans isomerase-like protein [Oryza sativa Japonica Group] gi|125557143|gb|EAZ02679.1| hypothetical protein OsI_24792 [Oryza sativa Indica Group] Length = 258 Score = 115 bits (289), Expect = 5e-24 Identities = 53/60 (88%), Positives = 58/60 (96%) Frame = +1 Query: 1 GGIRRIIVPPELGYPDNDYNQKGPRPTTFSGQRALSFVLRNQGLIDKTLLFDIELLKIVP 180 GG+RRIIVPP+LGYPDNDYN+ GP+PTTFSGQRAL FVLRNQGLIDKTLLFDIELLKI+P Sbjct: 197 GGVRRIIVPPDLGYPDNDYNKLGPKPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIP 256 >tpg|DAA48874.1| TPA: putative FKBP-like peptidyl-prolyl cis-trans isomerase family protein [Zea mays] Length = 198 Score = 115 bits (289), Expect = 5e-24 Identities = 53/60 (88%), Positives = 58/60 (96%) Frame = +1 Query: 1 GGIRRIIVPPELGYPDNDYNQKGPRPTTFSGQRALSFVLRNQGLIDKTLLFDIELLKIVP 180 GG+RRIIVPP+LGYPDNDYN+ GP+PTTFSGQRAL FVLRNQGLIDKTLLFDIELLKI+P Sbjct: 137 GGVRRIIVPPDLGYPDNDYNKLGPKPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIP 196