BLASTX nr result
ID: Achyranthes23_contig00005960
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00005960 (221 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY23190.1| Pentatricopeptide repeat (PPR) superfamily protei... 112 4e-23 ref|XP_006347788.1| PREDICTED: pentatricopeptide repeat-containi... 112 5e-23 ref|XP_004231241.1| PREDICTED: pentatricopeptide repeat-containi... 112 5e-23 ref|XP_002510791.1| pentatricopeptide repeat-containing protein,... 108 7e-22 gb|EXC15982.1| hypothetical protein L484_015785 [Morus notabilis] 105 8e-21 ref|XP_004308089.1| PREDICTED: pentatricopeptide repeat-containi... 105 8e-21 gb|EMJ21260.1| hypothetical protein PRUPE_ppa025794mg [Prunus pe... 103 2e-20 ref|XP_004496572.1| PREDICTED: pentatricopeptide repeat-containi... 102 7e-20 ref|XP_004157226.1| PREDICTED: pentatricopeptide repeat-containi... 100 2e-19 ref|XP_004140840.1| PREDICTED: pentatricopeptide repeat-containi... 100 2e-19 ref|NP_191564.1| pentatricopeptide repeat-containing protein [Ar... 100 3e-19 ref|XP_006421917.1| hypothetical protein CICLE_v10004849mg [Citr... 99 4e-19 ref|XP_002878314.1| pentatricopeptide repeat-containing protein ... 99 4e-19 emb|CBI22748.3| unnamed protein product [Vitis vinifera] 99 4e-19 ref|XP_002268211.1| PREDICTED: pentatricopeptide repeat-containi... 99 4e-19 ref|XP_003556107.1| PREDICTED: pentatricopeptide repeat-containi... 99 6e-19 gb|EPS57950.1| hypothetical protein M569_16866, partial [Genlise... 98 1e-18 ref|XP_006291028.1| hypothetical protein CARUB_v10017142mg [Caps... 98 1e-18 ref|XP_003535615.1| PREDICTED: pentatricopeptide repeat-containi... 98 1e-18 gb|AAF79508.1|AC002328_16 F20N2.6 [Arabidopsis thaliana] 97 2e-18 >gb|EOY23190.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] Length = 488 Score = 112 bits (281), Expect = 4e-23 Identities = 51/72 (70%), Positives = 61/72 (84%) Frame = -3 Query: 219 KTFNHRPFKHSYNAILVALLRVNHYRLIDWVYRKMLADDHLPDTLTYNVLICAQYRLGKM 40 KTFN+RPFKHSYNAIL LL VN Y+LI+WVY++MLA+ PDTLTYN+L+CA+YRLGK+ Sbjct: 225 KTFNYRPFKHSYNAILHTLLVVNQYKLIEWVYQQMLAEGLAPDTLTYNILMCAEYRLGKL 284 Query: 39 DNVHLLLDEMSR 4 D H LLDEM R Sbjct: 285 DQFHRLLDEMGR 296 >ref|XP_006347788.1| PREDICTED: pentatricopeptide repeat-containing protein At3g60050-like [Solanum tuberosum] Length = 491 Score = 112 bits (280), Expect = 5e-23 Identities = 48/72 (66%), Positives = 62/72 (86%) Frame = -3 Query: 219 KTFNHRPFKHSYNAILVALLRVNHYRLIDWVYRKMLADDHLPDTLTYNVLICAQYRLGKM 40 KTFN+RPF+HS+NAIL +LL VN YRLI+WVY++ML + H+PD LTYN+L+C++YRLGK+ Sbjct: 228 KTFNYRPFRHSFNAILHSLLGVNQYRLIEWVYQQMLVEGHIPDILTYNILLCSKYRLGKL 287 Query: 39 DNVHLLLDEMSR 4 D H LLDEM R Sbjct: 288 DQFHRLLDEMGR 299 >ref|XP_004231241.1| PREDICTED: pentatricopeptide repeat-containing protein At3g60050-like [Solanum lycopersicum] Length = 491 Score = 112 bits (280), Expect = 5e-23 Identities = 48/72 (66%), Positives = 62/72 (86%) Frame = -3 Query: 219 KTFNHRPFKHSYNAILVALLRVNHYRLIDWVYRKMLADDHLPDTLTYNVLICAQYRLGKM 40 KTFN+RPF+HS+NAIL +LL VN YRLI+WVY++ML + H+PD LTYN+L+C++YRLGK+ Sbjct: 228 KTFNYRPFRHSFNAILHSLLGVNQYRLIEWVYQQMLVEGHIPDILTYNILLCSKYRLGKL 287 Query: 39 DNVHLLLDEMSR 4 D H LLDEM R Sbjct: 288 DQFHRLLDEMGR 299 >ref|XP_002510791.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223549906|gb|EEF51393.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 475 Score = 108 bits (270), Expect = 7e-22 Identities = 46/72 (63%), Positives = 62/72 (86%) Frame = -3 Query: 219 KTFNHRPFKHSYNAILVALLRVNHYRLIDWVYRKMLADDHLPDTLTYNVLICAQYRLGKM 40 KTFN+RPFKHSYNAIL++LL + Y+LI+WV+++ML + + PDTLTYN+L+CA+YRLGK+ Sbjct: 216 KTFNYRPFKHSYNAILLSLLAIREYKLIEWVHQQMLVEGYCPDTLTYNILMCAKYRLGKL 275 Query: 39 DNVHLLLDEMSR 4 + H LLDEM R Sbjct: 276 HHFHRLLDEMGR 287 >gb|EXC15982.1| hypothetical protein L484_015785 [Morus notabilis] Length = 498 Score = 105 bits (261), Expect = 8e-21 Identities = 49/73 (67%), Positives = 57/73 (78%) Frame = -3 Query: 219 KTFNHRPFKHSYNAILVALLRVNHYRLIDWVYRKMLADDHLPDTLTYNVLICAQYRLGKM 40 KTFN RPFKHSYNAIL LL N Y+LI+WVY++MLAD PD LTYNVL+ +YRLGK+ Sbjct: 235 KTFNFRPFKHSYNAILHCLLVTNQYKLIEWVYQQMLADGFSPDILTYNVLMLTKYRLGKL 294 Query: 39 DNVHLLLDEMSRK 1 D H LLDEM R+ Sbjct: 295 DQFHRLLDEMGRR 307 >ref|XP_004308089.1| PREDICTED: pentatricopeptide repeat-containing protein At1g55630-like [Fragaria vesca subsp. vesca] Length = 486 Score = 105 bits (261), Expect = 8e-21 Identities = 46/72 (63%), Positives = 60/72 (83%) Frame = -3 Query: 219 KTFNHRPFKHSYNAILVALLRVNHYRLIDWVYRKMLADDHLPDTLTYNVLICAQYRLGKM 40 KTFN RPFKHSYNAIL++LL V Y+LI+W+Y++MLA+ + D LTYN+++CA+YRLGK+ Sbjct: 223 KTFNFRPFKHSYNAILLSLLVVKQYKLIEWLYQQMLAEGYSQDILTYNIMMCAKYRLGKL 282 Query: 39 DNVHLLLDEMSR 4 D H LLDEM R Sbjct: 283 DQFHRLLDEMGR 294 >gb|EMJ21260.1| hypothetical protein PRUPE_ppa025794mg [Prunus persica] Length = 446 Score = 103 bits (257), Expect = 2e-20 Identities = 47/72 (65%), Positives = 59/72 (81%) Frame = -3 Query: 219 KTFNHRPFKHSYNAILVALLRVNHYRLIDWVYRKMLADDHLPDTLTYNVLICAQYRLGKM 40 KTFN+RPFKHSYNAIL +L+ V Y+LI+WVY++MLAD H D LTYNV++ A+YRLGK+ Sbjct: 183 KTFNYRPFKHSYNAILHSLVVVKQYKLIEWVYQQMLADGHCTDILTYNVMMYAKYRLGKL 242 Query: 39 DNVHLLLDEMSR 4 D H LL+EM R Sbjct: 243 DQFHRLLEEMGR 254 >ref|XP_004496572.1| PREDICTED: pentatricopeptide repeat-containing protein At1g55630-like isoform X1 [Cicer arietinum] gi|502119305|ref|XP_004496573.1| PREDICTED: pentatricopeptide repeat-containing protein At1g55630-like isoform X2 [Cicer arietinum] gi|502119308|ref|XP_004496574.1| PREDICTED: pentatricopeptide repeat-containing protein At1g55630-like isoform X3 [Cicer arietinum] Length = 479 Score = 102 bits (253), Expect = 7e-20 Identities = 46/72 (63%), Positives = 58/72 (80%) Frame = -3 Query: 219 KTFNHRPFKHSYNAILVALLRVNHYRLIDWVYRKMLADDHLPDTLTYNVLICAQYRLGKM 40 KTFN+RPFKHSYNAIL +LL +N Y+LI+WVY +ML D D LTYN+++ A+YRLGK+ Sbjct: 217 KTFNYRPFKHSYNAILHSLLVLNQYKLIEWVYEQMLLDGFSSDVLTYNIVMYAKYRLGKV 276 Query: 39 DNVHLLLDEMSR 4 D H+LLDEM R Sbjct: 277 DQFHILLDEMER 288 >ref|XP_004157226.1| PREDICTED: pentatricopeptide repeat-containing protein At1g55630-like [Cucumis sativus] Length = 476 Score = 100 bits (250), Expect = 2e-19 Identities = 47/73 (64%), Positives = 56/73 (76%) Frame = -3 Query: 219 KTFNHRPFKHSYNAILVALLRVNHYRLIDWVYRKMLADDHLPDTLTYNVLICAQYRLGKM 40 KTFN RP+KHSYNAIL L+ V Y+LI WVY +ML DDH PD LTYNVL+ + +LGK+ Sbjct: 213 KTFNFRPYKHSYNAILHGLVIVKQYKLIGWVYDQMLLDDHSPDILTYNVLLFSSCKLGKL 272 Query: 39 DNVHLLLDEMSRK 1 D H LLDEM+RK Sbjct: 273 DQFHRLLDEMARK 285 >ref|XP_004140840.1| PREDICTED: pentatricopeptide repeat-containing protein At1g55630-like [Cucumis sativus] Length = 476 Score = 100 bits (250), Expect = 2e-19 Identities = 47/73 (64%), Positives = 56/73 (76%) Frame = -3 Query: 219 KTFNHRPFKHSYNAILVALLRVNHYRLIDWVYRKMLADDHLPDTLTYNVLICAQYRLGKM 40 KTFN RP+KHSYNAIL L+ V Y+LI WVY +ML DDH PD LTYNVL+ + +LGK+ Sbjct: 213 KTFNFRPYKHSYNAILHGLVIVKQYKLIGWVYDQMLLDDHSPDILTYNVLLFSSCKLGKL 272 Query: 39 DNVHLLLDEMSRK 1 D H LLDEM+RK Sbjct: 273 DQFHRLLDEMARK 285 >ref|NP_191564.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75181813|sp|Q9M1D8.1|PP288_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g60050 gi|7076758|emb|CAB75920.1| putative protein [Arabidopsis thaliana] gi|332646485|gb|AEE80006.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 473 Score = 100 bits (248), Expect = 3e-19 Identities = 46/72 (63%), Positives = 55/72 (76%) Frame = -3 Query: 219 KTFNHRPFKHSYNAILVALLRVNHYRLIDWVYRKMLADDHLPDTLTYNVLICAQYRLGKM 40 KTFN+RPFKHSYNAIL +LL V Y+LI+WVY++ML D PD LTYN+L+ YRLGKM Sbjct: 211 KTFNYRPFKHSYNAILNSLLGVKQYKLIEWVYKQMLEDGFSPDVLTYNILLWTNYRLGKM 270 Query: 39 DNVHLLLDEMSR 4 D L DEM+R Sbjct: 271 DRFDRLFDEMAR 282 >ref|XP_006421917.1| hypothetical protein CICLE_v10004849mg [Citrus clementina] gi|568874561|ref|XP_006490383.1| PREDICTED: pentatricopeptide repeat-containing protein At1g55630-like [Citrus sinensis] gi|557523790|gb|ESR35157.1| hypothetical protein CICLE_v10004849mg [Citrus clementina] Length = 487 Score = 99.4 bits (246), Expect = 4e-19 Identities = 44/72 (61%), Positives = 57/72 (79%) Frame = -3 Query: 219 KTFNHRPFKHSYNAILVALLRVNHYRLIDWVYRKMLADDHLPDTLTYNVLICAQYRLGKM 40 K FN RPFK+SYNAIL ALL + Y+LI+WVY++M + + PD LTYN+++CA+YRLGK+ Sbjct: 224 KLFNFRPFKNSYNAILHALLGIRQYKLIEWVYQQMSDEGYAPDILTYNIVMCAKYRLGKL 283 Query: 39 DNVHLLLDEMSR 4 D H LLDEM R Sbjct: 284 DQFHRLLDEMGR 295 >ref|XP_002878314.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297324152|gb|EFH54573.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 475 Score = 99.4 bits (246), Expect = 4e-19 Identities = 46/72 (63%), Positives = 54/72 (75%) Frame = -3 Query: 219 KTFNHRPFKHSYNAILVALLRVNHYRLIDWVYRKMLADDHLPDTLTYNVLICAQYRLGKM 40 KTFN+RPFKHSYNAIL +LL V Y+LI+WVY +ML D PD LTYN+L+ YRLGKM Sbjct: 213 KTFNYRPFKHSYNAILNSLLGVKQYKLIEWVYEQMLEDGFSPDVLTYNILLWTNYRLGKM 272 Query: 39 DNVHLLLDEMSR 4 D L DEM+R Sbjct: 273 DRFDRLFDEMAR 284 >emb|CBI22748.3| unnamed protein product [Vitis vinifera] Length = 518 Score = 99.4 bits (246), Expect = 4e-19 Identities = 41/70 (58%), Positives = 57/70 (81%) Frame = -3 Query: 219 KTFNHRPFKHSYNAILVALLRVNHYRLIDWVYRKMLADDHLPDTLTYNVLICAQYRLGKM 40 K FN+RPFKHSYNAIL LL + Y+L++WVY++ML +D+ PD LTYN+++C +YRLGK+ Sbjct: 255 KNFNYRPFKHSYNAILHCLLCLKQYKLVEWVYQQMLLEDYSPDILTYNIVMCTKYRLGKL 314 Query: 39 DNVHLLLDEM 10 D H LL+E+ Sbjct: 315 DQFHRLLEEL 324 >ref|XP_002268211.1| PREDICTED: pentatricopeptide repeat-containing protein At1g55630-like [Vitis vinifera] Length = 514 Score = 99.4 bits (246), Expect = 4e-19 Identities = 41/70 (58%), Positives = 57/70 (81%) Frame = -3 Query: 219 KTFNHRPFKHSYNAILVALLRVNHYRLIDWVYRKMLADDHLPDTLTYNVLICAQYRLGKM 40 K FN+RPFKHSYNAIL LL + Y+L++WVY++ML +D+ PD LTYN+++C +YRLGK+ Sbjct: 251 KNFNYRPFKHSYNAILHCLLCLKQYKLVEWVYQQMLLEDYSPDILTYNIVMCTKYRLGKL 310 Query: 39 DNVHLLLDEM 10 D H LL+E+ Sbjct: 311 DQFHRLLEEL 320 >ref|XP_003556107.1| PREDICTED: pentatricopeptide repeat-containing protein At1g55630-like isoformX2 [Glycine max] gi|571567703|ref|XP_006606113.1| PREDICTED: pentatricopeptide repeat-containing protein At1g55630-like isoform X3 [Glycine max] gi|571567708|ref|XP_006606114.1| PREDICTED: pentatricopeptide repeat-containing protein At1g55630-like isoform X4 [Glycine max] Length = 480 Score = 99.0 bits (245), Expect = 6e-19 Identities = 46/72 (63%), Positives = 56/72 (77%) Frame = -3 Query: 219 KTFNHRPFKHSYNAILVALLRVNHYRLIDWVYRKMLADDHLPDTLTYNVLICAQYRLGKM 40 KTFN RPFKHSYNAIL LL +N Y+LI+WVY++ML D D LTYN+++ A+YRLGK+ Sbjct: 218 KTFNFRPFKHSYNAILHGLLVLNQYKLIEWVYQQMLLDGFPSDILTYNIVMYAKYRLGKL 277 Query: 39 DNVHLLLDEMSR 4 D H LLDEM R Sbjct: 278 DQFHRLLDEMGR 289 >gb|EPS57950.1| hypothetical protein M569_16866, partial [Genlisea aurea] Length = 400 Score = 98.2 bits (243), Expect = 1e-18 Identities = 42/72 (58%), Positives = 58/72 (80%) Frame = -3 Query: 219 KTFNHRPFKHSYNAILVALLRVNHYRLIDWVYRKMLADDHLPDTLTYNVLICAQYRLGKM 40 K F +RP++ SYNAIL +L+ N Y+LI+WVYR+ML D H PD LTYN+++CA++RLGK+ Sbjct: 138 KNFKYRPYRSSYNAILRSLVIQNSYKLIEWVYRRMLRDGHSPDVLTYNIVMCAKFRLGKL 197 Query: 39 DNVHLLLDEMSR 4 D H ++DEMSR Sbjct: 198 DEFHGVVDEMSR 209 >ref|XP_006291028.1| hypothetical protein CARUB_v10017142mg [Capsella rubella] gi|482559735|gb|EOA23926.1| hypothetical protein CARUB_v10017142mg [Capsella rubella] Length = 475 Score = 98.2 bits (243), Expect = 1e-18 Identities = 45/72 (62%), Positives = 54/72 (75%) Frame = -3 Query: 219 KTFNHRPFKHSYNAILVALLRVNHYRLIDWVYRKMLADDHLPDTLTYNVLICAQYRLGKM 40 KTFN+RPFKHSYNAIL +LL V Y+LI+WVY +ML D PD LTYN+L+ YRLGKM Sbjct: 213 KTFNYRPFKHSYNAILNSLLGVKQYKLIEWVYEQMLEDGFAPDVLTYNILLWTNYRLGKM 272 Query: 39 DNVHLLLDEMSR 4 + L DEM+R Sbjct: 273 ERFDRLFDEMAR 284 >ref|XP_003535615.1| PREDICTED: pentatricopeptide repeat-containing protein At3g60050-like isoform X1 [Glycine max] gi|571484383|ref|XP_006589544.1| PREDICTED: pentatricopeptide repeat-containing protein At3g60050-like isoform X2 [Glycine max] gi|571484385|ref|XP_006589545.1| PREDICTED: pentatricopeptide repeat-containing protein At3g60050-like isoform X3 [Glycine max] Length = 480 Score = 98.2 bits (243), Expect = 1e-18 Identities = 45/72 (62%), Positives = 56/72 (77%) Frame = -3 Query: 219 KTFNHRPFKHSYNAILVALLRVNHYRLIDWVYRKMLADDHLPDTLTYNVLICAQYRLGKM 40 KTFN RPFKHSYNAIL LL +N Y+LI+WVY+++L D D LTYN+++ A+YRLGK+ Sbjct: 218 KTFNFRPFKHSYNAILHGLLVLNQYKLIEWVYQQLLLDGFSSDILTYNIVMYAKYRLGKL 277 Query: 39 DNVHLLLDEMSR 4 D H LLDEM R Sbjct: 278 DQFHRLLDEMGR 289 >gb|AAF79508.1|AC002328_16 F20N2.6 [Arabidopsis thaliana] Length = 554 Score = 97.4 bits (241), Expect = 2e-18 Identities = 44/70 (62%), Positives = 55/70 (78%) Frame = -3 Query: 219 KTFNHRPFKHSYNAILVALLRVNHYRLIDWVYRKMLADDHLPDTLTYNVLICAQYRLGKM 40 KTFN+RP+KHSYNAIL +LL V Y+LIDWVY +ML D PD LTYN+++ A +RLGK Sbjct: 291 KTFNYRPYKHSYNAILHSLLGVKQYKLIDWVYEQMLEDGFTPDVLTYNIVMFANFRLGKT 350 Query: 39 DNVHLLLDEM 10 D ++ LLDEM Sbjct: 351 DRLYRLLDEM 360