BLASTX nr result
ID: Achyranthes23_contig00005058
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00005058 (556 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002314859.2| hypothetical protein POPTR_0010s13450g [Popu... 57 4e-06 >ref|XP_002314859.2| hypothetical protein POPTR_0010s13450g [Populus trichocarpa] gi|550329723|gb|EEF01030.2| hypothetical protein POPTR_0010s13450g [Populus trichocarpa] Length = 206 Score = 56.6 bits (135), Expect = 4e-06 Identities = 24/48 (50%), Positives = 32/48 (66%), Gaps = 3/48 (6%) Frame = +2 Query: 320 LVDEQMSWGSTWFSFWEADNSN--CNEFYSDVM-EDDLWDFKSIQNTP 454 +VDEQMSWGS W FW+ D + C E +SDV+ +DD+W+ K I P Sbjct: 157 IVDEQMSWGSIWLPFWDVDYTGEACREMFSDVVWDDDIWNLKGIDKIP 204