BLASTX nr result
ID: Achyranthes23_contig00004793
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00004793 (487 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002301408.2| splicing factor-related family protein [Popu... 45 4e-06 ref|XP_006375364.1| hypothetical protein POPTR_0014s09370g [Popu... 45 5e-06 ref|XP_002320198.2| splicing factor-related family protein [Popu... 45 5e-06 >ref|XP_002301408.2| splicing factor-related family protein [Populus trichocarpa] gi|550345195|gb|EEE80681.2| splicing factor-related family protein [Populus trichocarpa] Length = 430 Score = 45.4 bits (106), Expect(2) = 4e-06 Identities = 21/34 (61%), Positives = 27/34 (79%) Frame = +2 Query: 347 SPFSTIYLNFSLVGGEGDFGSLLRSASMKAGQKE 448 +P ST+YL L+GG+G FGSLLR A+ KAGQK+ Sbjct: 91 TPESTVYLLLRLLGGKGGFGSLLRGAATKAGQKK 124 Score = 30.8 bits (68), Expect(2) = 4e-06 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +3 Query: 450 TNNFDACRDMSG 485 TNNFDACRDMSG Sbjct: 125 TNNFDACRDMSG 136 >ref|XP_006375364.1| hypothetical protein POPTR_0014s09370g [Populus trichocarpa] gi|550323827|gb|ERP53161.1| hypothetical protein POPTR_0014s09370g [Populus trichocarpa] Length = 467 Score = 45.1 bits (105), Expect(2) = 5e-06 Identities = 21/33 (63%), Positives = 26/33 (78%) Frame = +2 Query: 350 PFSTIYLNFSLVGGEGDFGSLLRSASMKAGQKE 448 P ST+YL L+GG+G FGSLLR A+ KAGQK+ Sbjct: 83 PESTVYLLLRLLGGKGGFGSLLRGAATKAGQKK 115 Score = 30.8 bits (68), Expect(2) = 5e-06 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +3 Query: 450 TNNFDACRDMSG 485 TNNFDACRDMSG Sbjct: 116 TNNFDACRDMSG 127 >ref|XP_002320198.2| splicing factor-related family protein [Populus trichocarpa] gi|550323826|gb|EEE98513.2| splicing factor-related family protein [Populus trichocarpa] Length = 381 Score = 45.1 bits (105), Expect(2) = 5e-06 Identities = 21/33 (63%), Positives = 26/33 (78%) Frame = +2 Query: 350 PFSTIYLNFSLVGGEGDFGSLLRSASMKAGQKE 448 P ST+YL L+GG+G FGSLLR A+ KAGQK+ Sbjct: 83 PESTVYLLLRLLGGKGGFGSLLRGAATKAGQKK 115 Score = 30.8 bits (68), Expect(2) = 5e-06 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +3 Query: 450 TNNFDACRDMSG 485 TNNFDACRDMSG Sbjct: 116 TNNFDACRDMSG 127