BLASTX nr result
ID: Achyranthes23_contig00004702
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00004702 (349 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003571537.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [... 61 1e-07 gb|EOY30945.1| 3-ketoacyl-CoA synthase [Theobroma cacao] 60 4e-07 gb|AGK29990.1| 3-ketoacyl-CoA synthase 11 [Gossypium raimondii] 59 9e-07 ref|XP_004951508.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [... 58 1e-06 gb|ACR36808.1| unknown [Zea mays] gi|413936839|gb|AFW71390.1| fa... 58 1e-06 ref|NP_001151591.1| fatty acid elongase [Zea mays] gi|195647992|... 58 1e-06 gb|EAZ01557.1| hypothetical protein OsI_23590 [Oryza sativa Indi... 57 2e-06 gb|EMJ06036.1| hypothetical protein PRUPE_ppa004269mg [Prunus pe... 57 3e-06 gb|AFW87109.1| putative fatty acid elongase isoform 1 [Zea mays]... 57 3e-06 ref|XP_002453517.1| hypothetical protein SORBIDRAFT_04g007190 [S... 57 3e-06 ref|XP_002437234.1| hypothetical protein SORBIDRAFT_10g023290 [S... 57 3e-06 ref|NP_001266579.1| fatty acid elongase [Zea mays] gi|195629768|... 57 3e-06 ref|NP_001105135.1| fatty acid elongase1 [Zea mays] gi|9714501|e... 57 3e-06 ref|XP_006483306.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [... 56 4e-06 ref|XP_006450506.1| hypothetical protein CICLE_v10008045mg [Citr... 56 4e-06 ref|XP_006656205.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [... 56 6e-06 gb|EMJ24349.1| hypothetical protein PRUPE_ppa004354mg [Prunus pe... 56 6e-06 gb|EOY31420.1| 3-ketoacyl-CoA synthase [Theobroma cacao] 55 7e-06 ref|XP_004508546.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like i... 55 7e-06 ref|XP_004508544.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like i... 55 7e-06 >ref|XP_003571537.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Brachypodium distachyon] Length = 519 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -2 Query: 348 LRGVNPAKERNPWMDEIDSFPVDVPKVSSIS 256 LR VNPAKE+NPWMDEID+FPVDVPKVS +S Sbjct: 487 LRSVNPAKEKNPWMDEIDTFPVDVPKVSKVS 517 >gb|EOY30945.1| 3-ketoacyl-CoA synthase [Theobroma cacao] Length = 514 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -2 Query: 348 LRGVNPAKERNPWMDEIDSFPVDVPKVSSI 259 LR VNPAKE+NPWMDEID FPVDVP+VSSI Sbjct: 485 LRAVNPAKEKNPWMDEIDRFPVDVPRVSSI 514 >gb|AGK29990.1| 3-ketoacyl-CoA synthase 11 [Gossypium raimondii] Length = 510 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -2 Query: 348 LRGVNPAKERNPWMDEIDSFPVDVPKVSSI 259 LR VNPAKE+NPWMDEI +FPVDVPKVSSI Sbjct: 481 LRTVNPAKEKNPWMDEIQNFPVDVPKVSSI 510 >ref|XP_004951508.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Setaria italica] Length = 885 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -2 Query: 348 LRGVNPAKERNPWMDEIDSFPVDVPKVSSIS 256 LR VNPA+E NPWMDEID FPVDVPKVS +S Sbjct: 853 LRSVNPAEETNPWMDEIDRFPVDVPKVSKVS 883 >gb|ACR36808.1| unknown [Zea mays] gi|413936839|gb|AFW71390.1| fatty acid elongase [Zea mays] Length = 517 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -2 Query: 348 LRGVNPAKERNPWMDEIDSFPVDVPKVSSIS 256 LR VNPA+E NPWMDEID FPVDVPKVS +S Sbjct: 485 LRSVNPAEETNPWMDEIDRFPVDVPKVSKVS 515 >ref|NP_001151591.1| fatty acid elongase [Zea mays] gi|195647992|gb|ACG43464.1| fatty acid elongase [Zea mays] Length = 517 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -2 Query: 348 LRGVNPAKERNPWMDEIDSFPVDVPKVSSIS 256 LR VNPA+E NPWMDEID FPVDVPKVS +S Sbjct: 485 LRSVNPAEETNPWMDEIDRFPVDVPKVSKVS 515 >gb|EAZ01557.1| hypothetical protein OsI_23590 [Oryza sativa Indica Group] Length = 519 Score = 57.0 bits (136), Expect = 2e-06 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = -2 Query: 348 LRGVNPAKERNPWMDEIDSFPVDVPKVSSI 259 LR VNPAKE+NPWMDEID+FPV+VPK+S + Sbjct: 487 LRTVNPAKEKNPWMDEIDNFPVEVPKISKV 516 >gb|EMJ06036.1| hypothetical protein PRUPE_ppa004269mg [Prunus persica] Length = 519 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/29 (79%), Positives = 27/29 (93%) Frame = -2 Query: 348 LRGVNPAKERNPWMDEIDSFPVDVPKVSS 262 L+ +NPAKE+NPWMDEID FPVDVPKVS+ Sbjct: 490 LKSINPAKEKNPWMDEIDRFPVDVPKVST 518 >gb|AFW87109.1| putative fatty acid elongase isoform 1 [Zea mays] gi|413954461|gb|AFW87110.1| putative fatty acid elongase isoform 2 [Zea mays] Length = 515 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = -2 Query: 348 LRGVNPAKERNPWMDEIDSFPVDVPKVSSI 259 LR VNPAKE++PWMDEID+FPVDVPK+S + Sbjct: 483 LRTVNPAKEKSPWMDEIDNFPVDVPKISKV 512 >ref|XP_002453517.1| hypothetical protein SORBIDRAFT_04g007190 [Sorghum bicolor] gi|241933348|gb|EES06493.1| hypothetical protein SORBIDRAFT_04g007190 [Sorghum bicolor] Length = 524 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = -2 Query: 348 LRGVNPAKERNPWMDEIDSFPVDVPKVSSIS 256 LR VNPA+E NPWMDEID FPVDVPKVS ++ Sbjct: 492 LRSVNPAEETNPWMDEIDRFPVDVPKVSKVT 522 >ref|XP_002437234.1| hypothetical protein SORBIDRAFT_10g023290 [Sorghum bicolor] gi|241915457|gb|EER88601.1| hypothetical protein SORBIDRAFT_10g023290 [Sorghum bicolor] Length = 516 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = -2 Query: 348 LRGVNPAKERNPWMDEIDSFPVDVPKVSSI 259 LR VNPAKE++PWMDEID+FPVDVPK+S + Sbjct: 484 LRTVNPAKEKSPWMDEIDNFPVDVPKISKV 513 >ref|NP_001266579.1| fatty acid elongase [Zea mays] gi|195629768|gb|ACG36525.1| fatty acid elongase [Zea mays] Length = 515 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = -2 Query: 348 LRGVNPAKERNPWMDEIDSFPVDVPKVSSI 259 LR VNPAKE++PWMDEID+FPVDVPK+S + Sbjct: 483 LRTVNPAKEKSPWMDEIDNFPVDVPKISKV 512 >ref|NP_001105135.1| fatty acid elongase1 [Zea mays] gi|9714501|emb|CAC01441.1| putative fatty acid elongase [Zea mays] Length = 513 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = -2 Query: 348 LRGVNPAKERNPWMDEIDSFPVDVPKVSSI 259 LR VNPAKE++PWMDEID+FPVDVPK+S + Sbjct: 481 LRTVNPAKEKSPWMDEIDNFPVDVPKISKV 510 >ref|XP_006483306.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Citrus sinensis] Length = 511 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -2 Query: 348 LRGVNPAKERNPWMDEIDSFPVDVPKVSSI 259 LR +NPAKE+NPWMDEI FPVDVPKVS+I Sbjct: 482 LRTINPAKEKNPWMDEIHQFPVDVPKVSTI 511 >ref|XP_006450506.1| hypothetical protein CICLE_v10008045mg [Citrus clementina] gi|557553732|gb|ESR63746.1| hypothetical protein CICLE_v10008045mg [Citrus clementina] Length = 511 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -2 Query: 348 LRGVNPAKERNPWMDEIDSFPVDVPKVSSI 259 LR +NPAKE+NPWMDEI FPVDVPKVS+I Sbjct: 482 LRTINPAKEKNPWMDEIHQFPVDVPKVSTI 511 >ref|XP_006656205.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Oryza brachyantha] Length = 519 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/30 (73%), Positives = 27/30 (90%) Frame = -2 Query: 348 LRGVNPAKERNPWMDEIDSFPVDVPKVSSI 259 LR VNPA+E NPWMDEID+FPVD+PK+S + Sbjct: 487 LRTVNPAEEENPWMDEIDNFPVDIPKISKV 516 >gb|EMJ24349.1| hypothetical protein PRUPE_ppa004354mg [Prunus persica] Length = 515 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -2 Query: 348 LRGVNPAKERNPWMDEIDSFPVDVPKVSSI 259 LR VNPAKE+NPWMDEI FPVDVPKVS++ Sbjct: 486 LRTVNPAKEKNPWMDEIHQFPVDVPKVSAL 515 >gb|EOY31420.1| 3-ketoacyl-CoA synthase [Theobroma cacao] Length = 505 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -2 Query: 348 LRGVNPAKERNPWMDEIDSFPVDVPKVSSI 259 LR +NPAKER+PWMDEI FPVDVPKVS+I Sbjct: 476 LRTINPAKERSPWMDEIHQFPVDVPKVSAI 505 >ref|XP_004508546.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like isoform X3 [Cicer arietinum] Length = 390 Score = 55.5 bits (132), Expect = 7e-06 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = -2 Query: 348 LRGVNPAKERNPWMDEIDSFPVDVPKVSSI 259 LR +NPAKE++PW+DEID FPVDVPKVS+I Sbjct: 361 LRTINPAKEKSPWIDEIDQFPVDVPKVSTI 390 >ref|XP_004508544.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like isoform X1 [Cicer arietinum] Length = 504 Score = 55.5 bits (132), Expect = 7e-06 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = -2 Query: 348 LRGVNPAKERNPWMDEIDSFPVDVPKVSSI 259 LR +NPAKE++PW+DEID FPVDVPKVS+I Sbjct: 475 LRTINPAKEKSPWIDEIDQFPVDVPKVSTI 504