BLASTX nr result
ID: Achyranthes23_contig00004321
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00004321 (201 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002869571.1| GH3.5/WES1 [Arabidopsis lyrata subsp. lyrata... 130 1e-28 ref|XP_002533739.1| Indole-3-acetic acid-amido synthetase GH3.6,... 130 1e-28 ref|XP_006280192.1| hypothetical protein CARUB_v10026098mg [Caps... 130 2e-28 ref|XP_004510013.1| PREDICTED: indole-3-acetic acid-amido synthe... 130 2e-28 gb|EMJ15997.1| hypothetical protein PRUPE_ppa002986mg [Prunus pe... 129 3e-28 ref|XP_004149936.1| PREDICTED: indole-3-acetic acid-amido synthe... 129 4e-28 ref|XP_006401565.1| hypothetical protein EUTSA_v10012997mg [Eutr... 129 5e-28 ref|XP_004244168.1| PREDICTED: indole-3-acetic acid-amido synthe... 129 5e-28 ref|NP_194456.1| indole-3-acetic acid-amido synthetase GH3.5 [Ar... 129 5e-28 emb|CBI20465.3| unnamed protein product [Vitis vinifera] 129 5e-28 ref|XP_002283236.1| PREDICTED: indole-3-acetic acid-amido synthe... 129 5e-28 ref|XP_002283229.1| PREDICTED: indole-3-acetic acid-amido synthe... 129 5e-28 gb|EXB50903.1| hypothetical protein L484_021129 [Morus notabilis] 128 9e-28 gb|EOY12664.1| Auxin-responsive GH3 family protein [Theobroma ca... 128 9e-28 ref|XP_004294315.1| PREDICTED: indole-3-acetic acid-amido synthe... 128 9e-28 ref|XP_003540050.1| PREDICTED: indole-3-acetic acid-amido synthe... 128 9e-28 ref|XP_006360114.1| PREDICTED: indole-3-acetic acid-amido synthe... 127 1e-27 ref|XP_006283319.1| hypothetical protein CARUB_v10004357mg, part... 127 1e-27 ref|XP_002866046.1| hypothetical protein ARALYDRAFT_918581 [Arab... 127 2e-27 ref|XP_002316954.1| DWARF IN LIGHT 1 family protein [Populus tri... 127 2e-27 >ref|XP_002869571.1| GH3.5/WES1 [Arabidopsis lyrata subsp. lyrata] gi|297315407|gb|EFH45830.1| GH3.5/WES1 [Arabidopsis lyrata subsp. lyrata] Length = 612 Score = 130 bits (328), Expect = 1e-28 Identities = 62/66 (93%), Positives = 65/66 (98%) Frame = -3 Query: 199 ESIGPLEIKIVENGTFDKLMDYAISLGASINQYKTPRCVKFAPIVELLNSRVVSSYLSPK 20 +SIGPLEIKIVE GTFDKLMDYAISLGASINQYKTPRCVKFAPI+ELLNSRVV+SYLSPK Sbjct: 539 KSIGPLEIKIVEPGTFDKLMDYAISLGASINQYKTPRCVKFAPIIELLNSRVVNSYLSPK 598 Query: 19 CPKWVP 2 CPKWVP Sbjct: 599 CPKWVP 604 >ref|XP_002533739.1| Indole-3-acetic acid-amido synthetase GH3.6, putative [Ricinus communis] gi|223526345|gb|EEF28642.1| Indole-3-acetic acid-amido synthetase GH3.6, putative [Ricinus communis] Length = 612 Score = 130 bits (328), Expect = 1e-28 Identities = 63/66 (95%), Positives = 64/66 (96%) Frame = -3 Query: 199 ESIGPLEIKIVENGTFDKLMDYAISLGASINQYKTPRCVKFAPIVELLNSRVVSSYLSPK 20 +SIGPLEIKIVE GTFDKLMDYAISLGASINQYKTPRCVKFAPIVELLNSRVVSSY SPK Sbjct: 538 KSIGPLEIKIVEPGTFDKLMDYAISLGASINQYKTPRCVKFAPIVELLNSRVVSSYFSPK 597 Query: 19 CPKWVP 2 CPKWVP Sbjct: 598 CPKWVP 603 >ref|XP_006280192.1| hypothetical protein CARUB_v10026098mg [Capsella rubella] gi|482548896|gb|EOA13090.1| hypothetical protein CARUB_v10026098mg [Capsella rubella] Length = 613 Score = 130 bits (327), Expect = 2e-28 Identities = 61/66 (92%), Positives = 65/66 (98%) Frame = -3 Query: 199 ESIGPLEIKIVENGTFDKLMDYAISLGASINQYKTPRCVKFAPIVELLNSRVVSSYLSPK 20 +SIGPLEIKIVE+GTFDKLMDYAISLGASINQYKTPRCVKFAPI+ELLNSRVV+SY SPK Sbjct: 540 KSIGPLEIKIVESGTFDKLMDYAISLGASINQYKTPRCVKFAPIIELLNSRVVNSYFSPK 599 Query: 19 CPKWVP 2 CPKWVP Sbjct: 600 CPKWVP 605 >ref|XP_004510013.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Cicer arietinum] Length = 606 Score = 130 bits (326), Expect = 2e-28 Identities = 61/66 (92%), Positives = 64/66 (96%) Frame = -3 Query: 199 ESIGPLEIKIVENGTFDKLMDYAISLGASINQYKTPRCVKFAPIVELLNSRVVSSYLSPK 20 +SIGPLEIKIVE GTFDKLMDYAISLGASINQYKTPRCVKFAP+VELLNSRV+SSY SPK Sbjct: 532 KSIGPLEIKIVEQGTFDKLMDYAISLGASINQYKTPRCVKFAPVVELLNSRVMSSYFSPK 591 Query: 19 CPKWVP 2 CPKWVP Sbjct: 592 CPKWVP 597 >gb|EMJ15997.1| hypothetical protein PRUPE_ppa002986mg [Prunus persica] Length = 614 Score = 129 bits (325), Expect = 3e-28 Identities = 62/66 (93%), Positives = 64/66 (96%) Frame = -3 Query: 199 ESIGPLEIKIVENGTFDKLMDYAISLGASINQYKTPRCVKFAPIVELLNSRVVSSYLSPK 20 +SIGPLEIKIVE GTFDKLMDYAISLGASINQYKTPRCVKFAPIVELLNSRVVS+Y SPK Sbjct: 540 KSIGPLEIKIVEAGTFDKLMDYAISLGASINQYKTPRCVKFAPIVELLNSRVVSNYFSPK 599 Query: 19 CPKWVP 2 CPKWVP Sbjct: 600 CPKWVP 605 >ref|XP_004149936.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Cucumis sativus] gi|449516764|ref|XP_004165416.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Cucumis sativus] Length = 604 Score = 129 bits (324), Expect = 4e-28 Identities = 60/66 (90%), Positives = 63/66 (95%) Frame = -3 Query: 199 ESIGPLEIKIVENGTFDKLMDYAISLGASINQYKTPRCVKFAPIVELLNSRVVSSYLSPK 20 +SIGPLEIK+VENGTFDKLMDYAIS+GASINQYKTPRCVKF PIVELLNSRVV SY SPK Sbjct: 530 KSIGPLEIKVVENGTFDKLMDYAISMGASINQYKTPRCVKFQPIVELLNSRVVGSYFSPK 589 Query: 19 CPKWVP 2 CPKWVP Sbjct: 590 CPKWVP 595 >ref|XP_006401565.1| hypothetical protein EUTSA_v10012997mg [Eutrema salsugineum] gi|557102655|gb|ESQ43018.1| hypothetical protein EUTSA_v10012997mg [Eutrema salsugineum] Length = 612 Score = 129 bits (323), Expect = 5e-28 Identities = 60/66 (90%), Positives = 64/66 (96%) Frame = -3 Query: 199 ESIGPLEIKIVENGTFDKLMDYAISLGASINQYKTPRCVKFAPIVELLNSRVVSSYLSPK 20 +SIGPLEIKIVE+GTFDKLMDYAISLGASINQYKTPRCVKFAPI+ELLNSRVV +Y SPK Sbjct: 539 KSIGPLEIKIVESGTFDKLMDYAISLGASINQYKTPRCVKFAPIIELLNSRVVKTYFSPK 598 Query: 19 CPKWVP 2 CPKWVP Sbjct: 599 CPKWVP 604 >ref|XP_004244168.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Solanum lycopersicum] Length = 607 Score = 129 bits (323), Expect = 5e-28 Identities = 61/66 (92%), Positives = 64/66 (96%) Frame = -3 Query: 199 ESIGPLEIKIVENGTFDKLMDYAISLGASINQYKTPRCVKFAPIVELLNSRVVSSYLSPK 20 +SIGPLEIKIVE+GTFDKLMDYAISLGASINQYKTPRCVKF PIVELLNSRVVS+Y SPK Sbjct: 533 KSIGPLEIKIVESGTFDKLMDYAISLGASINQYKTPRCVKFEPIVELLNSRVVSNYFSPK 592 Query: 19 CPKWVP 2 CPKWVP Sbjct: 593 CPKWVP 598 >ref|NP_194456.1| indole-3-acetic acid-amido synthetase GH3.5 [Arabidopsis thaliana] gi|62900128|sp|O81829.1|GH35_ARATH RecName: Full=Indole-3-acetic acid-amido synthetase GH3.5; AltName: Full=Auxin-responsive GH3-like protein 5; Short=AtGH3-5 gi|3269287|emb|CAA19720.1| GH3 like protein [Arabidopsis thaliana] gi|7269579|emb|CAB79581.1| GH3 like protein [Arabidopsis thaliana] gi|17979055|gb|AAL49795.1| putative GH3 protein [Arabidopsis thaliana] gi|20465961|gb|AAM20166.1| putative GH3 protein [Arabidopsis thaliana] gi|98621984|gb|ABF58888.1| auxin-responsive GH3-like [Arabidopsis thaliana] gi|332659918|gb|AEE85318.1| indole-3-acetic acid-amido synthetase GH3.5 [Arabidopsis thaliana] Length = 612 Score = 129 bits (323), Expect = 5e-28 Identities = 61/66 (92%), Positives = 63/66 (95%) Frame = -3 Query: 199 ESIGPLEIKIVENGTFDKLMDYAISLGASINQYKTPRCVKFAPIVELLNSRVVSSYLSPK 20 +SIGPLEIKIVE GTFDKLMDYAISLGASINQYKTPRCVKFAPI+ELLNSRVV SY SPK Sbjct: 539 KSIGPLEIKIVEPGTFDKLMDYAISLGASINQYKTPRCVKFAPIIELLNSRVVDSYFSPK 598 Query: 19 CPKWVP 2 CPKWVP Sbjct: 599 CPKWVP 604 >emb|CBI20465.3| unnamed protein product [Vitis vinifera] Length = 569 Score = 129 bits (323), Expect = 5e-28 Identities = 59/66 (89%), Positives = 65/66 (98%) Frame = -3 Query: 199 ESIGPLEIKIVENGTFDKLMDYAISLGASINQYKTPRCVKFAPIVELLNSRVVSSYLSPK 20 +SIGPLE+KIVE+GTFDKLMDYAISLGASINQYKTPRCVKFAPI+ELLNSRVVS+Y SPK Sbjct: 495 KSIGPLEMKIVESGTFDKLMDYAISLGASINQYKTPRCVKFAPIIELLNSRVVSNYFSPK 554 Query: 19 CPKWVP 2 CPKW+P Sbjct: 555 CPKWIP 560 >ref|XP_002283236.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6 isoform 2 [Vitis vinifera] Length = 596 Score = 129 bits (323), Expect = 5e-28 Identities = 59/66 (89%), Positives = 65/66 (98%) Frame = -3 Query: 199 ESIGPLEIKIVENGTFDKLMDYAISLGASINQYKTPRCVKFAPIVELLNSRVVSSYLSPK 20 +SIGPLE+KIVE+GTFDKLMDYAISLGASINQYKTPRCVKFAPI+ELLNSRVVS+Y SPK Sbjct: 522 KSIGPLEMKIVESGTFDKLMDYAISLGASINQYKTPRCVKFAPIIELLNSRVVSNYFSPK 581 Query: 19 CPKWVP 2 CPKW+P Sbjct: 582 CPKWIP 587 >ref|XP_002283229.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6 isoform 1 [Vitis vinifera] gi|147866579|emb|CAN83696.1| hypothetical protein VITISV_013365 [Vitis vinifera] Length = 613 Score = 129 bits (323), Expect = 5e-28 Identities = 59/66 (89%), Positives = 65/66 (98%) Frame = -3 Query: 199 ESIGPLEIKIVENGTFDKLMDYAISLGASINQYKTPRCVKFAPIVELLNSRVVSSYLSPK 20 +SIGPLE+KIVE+GTFDKLMDYAISLGASINQYKTPRCVKFAPI+ELLNSRVVS+Y SPK Sbjct: 539 KSIGPLEMKIVESGTFDKLMDYAISLGASINQYKTPRCVKFAPIIELLNSRVVSNYFSPK 598 Query: 19 CPKWVP 2 CPKW+P Sbjct: 599 CPKWIP 604 >gb|EXB50903.1| hypothetical protein L484_021129 [Morus notabilis] Length = 611 Score = 128 bits (321), Expect = 9e-28 Identities = 61/66 (92%), Positives = 63/66 (95%) Frame = -3 Query: 199 ESIGPLEIKIVENGTFDKLMDYAISLGASINQYKTPRCVKFAPIVELLNSRVVSSYLSPK 20 +SIGPLEIKIVE GTFDKLMDYAISLGASINQYKTPRCVKFAPIVELLNSRVV+ Y SPK Sbjct: 537 KSIGPLEIKIVEAGTFDKLMDYAISLGASINQYKTPRCVKFAPIVELLNSRVVTEYFSPK 596 Query: 19 CPKWVP 2 CPKWVP Sbjct: 597 CPKWVP 602 >gb|EOY12664.1| Auxin-responsive GH3 family protein [Theobroma cacao] Length = 611 Score = 128 bits (321), Expect = 9e-28 Identities = 61/66 (92%), Positives = 63/66 (95%) Frame = -3 Query: 199 ESIGPLEIKIVENGTFDKLMDYAISLGASINQYKTPRCVKFAPIVELLNSRVVSSYLSPK 20 +SIGPLEIKIVE GTFDKLMDYAISLGASINQYKTPRCVKFAPIVELLNSR VSSY SPK Sbjct: 538 KSIGPLEIKIVEPGTFDKLMDYAISLGASINQYKTPRCVKFAPIVELLNSRAVSSYFSPK 597 Query: 19 CPKWVP 2 CPKW+P Sbjct: 598 CPKWLP 603 >ref|XP_004294315.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Fragaria vesca subsp. vesca] Length = 607 Score = 128 bits (321), Expect = 9e-28 Identities = 61/66 (92%), Positives = 63/66 (95%) Frame = -3 Query: 199 ESIGPLEIKIVENGTFDKLMDYAISLGASINQYKTPRCVKFAPIVELLNSRVVSSYLSPK 20 +SIGPLEIKIVE GTFDKLMDYAISLGASINQYKTPRCVKFAPIVELLNSRV S+Y SPK Sbjct: 532 KSIGPLEIKIVEAGTFDKLMDYAISLGASINQYKTPRCVKFAPIVELLNSRVASTYFSPK 591 Query: 19 CPKWVP 2 CPKWVP Sbjct: 592 CPKWVP 597 >ref|XP_003540050.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Glycine max] Length = 607 Score = 128 bits (321), Expect = 9e-28 Identities = 60/66 (90%), Positives = 62/66 (93%) Frame = -3 Query: 199 ESIGPLEIKIVENGTFDKLMDYAISLGASINQYKTPRCVKFAPIVELLNSRVVSSYLSPK 20 +SIGPLEIKIVE GTFDKLMDYAISLGASINQYKTPRCVKFAP+VELLNSRVV Y SPK Sbjct: 533 KSIGPLEIKIVEQGTFDKLMDYAISLGASINQYKTPRCVKFAPVVELLNSRVVEKYFSPK 592 Query: 19 CPKWVP 2 CPKWVP Sbjct: 593 CPKWVP 598 >ref|XP_006360114.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Solanum tuberosum] Length = 607 Score = 127 bits (320), Expect = 1e-27 Identities = 60/66 (90%), Positives = 64/66 (96%) Frame = -3 Query: 199 ESIGPLEIKIVENGTFDKLMDYAISLGASINQYKTPRCVKFAPIVELLNSRVVSSYLSPK 20 +SIGPLEIKIVE+GTFDKLMDYAISLGASINQYKTPRCVKF PIVELLNS+VVS+Y SPK Sbjct: 533 KSIGPLEIKIVESGTFDKLMDYAISLGASINQYKTPRCVKFEPIVELLNSKVVSNYFSPK 592 Query: 19 CPKWVP 2 CPKWVP Sbjct: 593 CPKWVP 598 >ref|XP_006283319.1| hypothetical protein CARUB_v10004357mg, partial [Capsella rubella] gi|482552024|gb|EOA16217.1| hypothetical protein CARUB_v10004357mg, partial [Capsella rubella] Length = 634 Score = 127 bits (320), Expect = 1e-27 Identities = 60/66 (90%), Positives = 63/66 (95%) Frame = -3 Query: 199 ESIGPLEIKIVENGTFDKLMDYAISLGASINQYKTPRCVKFAPIVELLNSRVVSSYLSPK 20 +SIGPLEIKIVE GTFDKLMDYAISLGASINQYKTPRCVKFAPI+ELLNSRVV +Y SPK Sbjct: 561 KSIGPLEIKIVEPGTFDKLMDYAISLGASINQYKTPRCVKFAPIIELLNSRVVDTYFSPK 620 Query: 19 CPKWVP 2 CPKWVP Sbjct: 621 CPKWVP 626 >ref|XP_002866046.1| hypothetical protein ARALYDRAFT_918581 [Arabidopsis lyrata subsp. lyrata] gi|297311881|gb|EFH42305.1| hypothetical protein ARALYDRAFT_918581 [Arabidopsis lyrata subsp. lyrata] Length = 612 Score = 127 bits (319), Expect = 2e-27 Identities = 59/66 (89%), Positives = 63/66 (95%) Frame = -3 Query: 199 ESIGPLEIKIVENGTFDKLMDYAISLGASINQYKTPRCVKFAPIVELLNSRVVSSYLSPK 20 +SIGPLEIK+VE+GTFDKLMDYAISLGASINQYKTPRCVKFAPI+ELLNSRVV SY SPK Sbjct: 539 KSIGPLEIKMVESGTFDKLMDYAISLGASINQYKTPRCVKFAPIIELLNSRVVDSYFSPK 598 Query: 19 CPKWVP 2 CPKW P Sbjct: 599 CPKWAP 604 >ref|XP_002316954.1| DWARF IN LIGHT 1 family protein [Populus trichocarpa] gi|222860019|gb|EEE97566.1| DWARF IN LIGHT 1 family protein [Populus trichocarpa] Length = 611 Score = 127 bits (319), Expect = 2e-27 Identities = 61/66 (92%), Positives = 62/66 (93%) Frame = -3 Query: 199 ESIGPLEIKIVENGTFDKLMDYAISLGASINQYKTPRCVKFAPIVELLNSRVVSSYLSPK 20 +SIGPLEIKIVE GTFDKLMDYAISLGASINQYKTPRCVKFAPIVELLNSR VS Y SPK Sbjct: 538 KSIGPLEIKIVEPGTFDKLMDYAISLGASINQYKTPRCVKFAPIVELLNSRAVSRYFSPK 597 Query: 19 CPKWVP 2 CPKWVP Sbjct: 598 CPKWVP 603