BLASTX nr result
ID: Achyranthes23_contig00004279
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00004279 (490 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003523046.1| PREDICTED: dnaJ homolog subfamily B member 1... 58 1e-06 gb|ESW29654.1| hypothetical protein PHAVU_002G087900g [Phaseolus... 57 2e-06 ref|XP_004299626.1| PREDICTED: dnaJ homolog subfamily B member 1... 57 2e-06 gb|EMJ11718.1| hypothetical protein PRUPE_ppa007705mg [Prunus pe... 57 2e-06 ref|XP_003527054.1| PREDICTED: dnaJ homolog subfamily B member 1... 57 2e-06 gb|EOY21692.1| DNAJ heat shock family protein isoform 1 [Theobro... 57 3e-06 emb|CBI15287.3| unnamed protein product [Vitis vinifera] 56 4e-06 ref|XP_002270193.1| PREDICTED: dnaJ homolog subfamily B member 1... 56 4e-06 gb|EXC34216.1| DnaJ homolog subfamily B member 4 [Morus notabilis] 56 6e-06 ref|XP_002511507.1| Chaperone protein dnaJ, putative [Ricinus co... 55 1e-05 >ref|XP_003523046.1| PREDICTED: dnaJ homolog subfamily B member 1-like [Glycine max] Length = 351 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +1 Query: 1 GNLRIKLDVKYPSRLTTEQKADLRRVLGGSS 93 GNLRIKLDVKYPSRLT EQK+DLRRVLGG S Sbjct: 321 GNLRIKLDVKYPSRLTPEQKSDLRRVLGGIS 351 >gb|ESW29654.1| hypothetical protein PHAVU_002G087900g [Phaseolus vulgaris] Length = 329 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +1 Query: 1 GNLRIKLDVKYPSRLTTEQKADLRRVLGGSS 93 GNLR+KLDVKYPSRLT EQK+DLRRVLGG S Sbjct: 299 GNLRVKLDVKYPSRLTPEQKSDLRRVLGGIS 329 >ref|XP_004299626.1| PREDICTED: dnaJ homolog subfamily B member 1-like [Fragaria vesca subsp. vesca] Length = 359 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +1 Query: 1 GNLRIKLDVKYPSRLTTEQKADLRRVLGGSS 93 GNLRIK DVKYPSRLTTEQK+DL+RVLGG S Sbjct: 328 GNLRIKFDVKYPSRLTTEQKSDLKRVLGGVS 358 >gb|EMJ11718.1| hypothetical protein PRUPE_ppa007705mg [Prunus persica] Length = 358 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +1 Query: 1 GNLRIKLDVKYPSRLTTEQKADLRRVLGGSS 93 GNLRIK DVKYPSRLTTEQK+DL+RVLGG S Sbjct: 327 GNLRIKFDVKYPSRLTTEQKSDLKRVLGGVS 357 >ref|XP_003527054.1| PREDICTED: dnaJ homolog subfamily B member 1-like isoform 1 [Glycine max] Length = 351 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +1 Query: 1 GNLRIKLDVKYPSRLTTEQKADLRRVLGGSS 93 GNLR+KLDVKYPSRLT EQK+DLRRVLGG S Sbjct: 321 GNLRVKLDVKYPSRLTPEQKSDLRRVLGGIS 351 >gb|EOY21692.1| DNAJ heat shock family protein isoform 1 [Theobroma cacao] Length = 408 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +1 Query: 1 GNLRIKLDVKYPSRLTTEQKADLRRVLGG 87 GNLRIKLDVKYPSRLT EQKA+LRRVLGG Sbjct: 378 GNLRIKLDVKYPSRLTAEQKAELRRVLGG 406 >emb|CBI15287.3| unnamed protein product [Vitis vinifera] Length = 315 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +1 Query: 1 GNLRIKLDVKYPSRLTTEQKADLRRVLGGSS 93 GNLRIK DV YPSRLT+EQK+DL+RVLGGSS Sbjct: 284 GNLRIKFDVNYPSRLTSEQKSDLKRVLGGSS 314 >ref|XP_002270193.1| PREDICTED: dnaJ homolog subfamily B member 13-like isoform 1 [Vitis vinifera] Length = 339 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +1 Query: 1 GNLRIKLDVKYPSRLTTEQKADLRRVLGGSS 93 GNLRIK DV YPSRLT+EQK+DL+RVLGGSS Sbjct: 308 GNLRIKFDVNYPSRLTSEQKSDLKRVLGGSS 338 >gb|EXC34216.1| DnaJ homolog subfamily B member 4 [Morus notabilis] Length = 193 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = +1 Query: 1 GNLRIKLDVKYPSRLTTEQKADLRRVLGG 87 GNLRIK DV+YPSRLT EQKADLRRVLGG Sbjct: 163 GNLRIKFDVRYPSRLTAEQKADLRRVLGG 191 >ref|XP_002511507.1| Chaperone protein dnaJ, putative [Ricinus communis] gi|223550622|gb|EEF52109.1| Chaperone protein dnaJ, putative [Ricinus communis] Length = 333 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = +1 Query: 1 GNLRIKLDVKYPSRLTTEQKADLRRVLGGSS 93 GNLRIK+DV+YPSRLT+EQK++LRRVLGG S Sbjct: 303 GNLRIKIDVRYPSRLTSEQKSELRRVLGGIS 333