BLASTX nr result
ID: Achyranthes23_contig00002792
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00002792 (1708 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531185.1| RSI-1 protein precursor, putative [Ricinus c... 59 8e-06 >ref|XP_002531185.1| RSI-1 protein precursor, putative [Ricinus communis] gi|223529226|gb|EEF31200.1| RSI-1 protein precursor, putative [Ricinus communis] Length = 95 Score = 58.5 bits (140), Expect = 8e-06 Identities = 27/50 (54%), Positives = 29/50 (58%) Frame = -2 Query: 552 YDIGFHESDCRPRCNYRCSATSHRKPXXXXXXXXXXXXXCVPAGTYGNKQ 403 Y F SDC+PRC YRCSATSH+KP CVP G YGNKQ Sbjct: 28 YGSRFRPSDCKPRCTYRCSATSHKKPCMFFCLKCCSKCLCVPPGVYGNKQ 77